BLASTX nr result
ID: Coptis25_contig00021212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021212 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus ... 54 3e-06 ref|XP_002312429.1| predicted protein [Populus trichocarpa] gi|2... 54 6e-06 ref|XP_002314817.1| predicted protein [Populus trichocarpa] gi|2... 53 8e-06 >ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534037|gb|EEF35756.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 451 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 164 SYYLLRAFASLKRYAVHATSSLLFQHHIFALFSLTMYITIFFNLL 30 S LL A ASL+ YAV S+LLF H+FALFSL++YI I+F LL Sbjct: 404 SAILLGAIASLRGYAVKEASALLFWQHVFALFSLSLYIVIYFRLL 448 Score = 22.3 bits (46), Expect(2) = 3e-06 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 238 NILDCDGQIYKFVLLLHNTIPTS 170 N L +Y+FVLLL T P++ Sbjct: 383 NFLVIGDAMYRFVLLLQYTTPSA 405 >ref|XP_002312429.1| predicted protein [Populus trichocarpa] gi|222852249|gb|EEE89796.1| predicted protein [Populus trichocarpa] Length = 437 Score = 53.5 bits (127), Expect(2) = 6e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 164 SYYLLRAFASLKRYAVHATSSLLFQHHIFALFSLTMYITIFFNLL 30 S LL A ASL+ YAV S+LLF H+FALFSL++YI I+F LL Sbjct: 390 SAILLGAIASLRGYAVKEASALLFWQHVFALFSLSLYIVIYFKLL 434 Score = 21.2 bits (43), Expect(2) = 6e-06 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 214 IYKFVLLLHNTIPTS 170 +Y+FVLLL T P++ Sbjct: 377 MYRFVLLLQYTTPSA 391 >ref|XP_002314817.1| predicted protein [Populus trichocarpa] gi|222863857|gb|EEF00988.1| predicted protein [Populus trichocarpa] Length = 449 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -1 Query: 164 SYYLLRAFASLKRYAVHATSSLLFQHHIFALFSLTMYITIFFNLL 30 S LL A ASL+ YAV S+LLF H+FALFSL++YI I+F LL Sbjct: 402 SAILLGAIASLRGYAVKEASALLFWQHVFALFSLSLYIIIYFKLL 446 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 214 IYKFVLLLHNTIPTS 170 +Y+FVLLL T P++ Sbjct: 389 MYRFVLLLQYTTPSA 403