BLASTX nr result
ID: Coptis25_contig00021203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021203 (751 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_191051.2| leucine rich repeat and F-Box domain-containing... 70 6e-10 dbj|BAD95186.1| hypothetical protein [Arabidopsis thaliana] 70 6e-10 emb|CAB41093.1| putative protein [Arabidopsis thaliana] 70 6e-10 ref|NP_200481.1| FBD / Leucine Rich Repeat domains containing pr... 68 2e-09 sp|Q9FJU2.2|FBD37_ARATH RecName: Full=Putative FBD-associated F-... 68 2e-09 >ref|NP_191051.2| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] gi|79315081|ref|NP_001030863.1| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] gi|145332847|ref|NP_001078289.1| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] gi|63003866|gb|AAY25462.1| At3g54910 [Arabidopsis thaliana] gi|332645789|gb|AEE79310.1| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] gi|332645790|gb|AEE79311.1| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] gi|332645791|gb|AEE79312.1| leucine rich repeat and F-Box domain-containing protein [Arabidopsis thaliana] Length = 373 Score = 69.7 bits (169), Expect = 6e-10 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 3/111 (2%) Frame = -2 Query: 684 LSGGLFTCISLTSLTLENFV-LDLPRTVGFPLLKTLKLDHVTIPSENLINKLFSNCPVLE 508 L L+TC SL L L + LD+PR P LKTL+L V +E+ +++L SNCPVLE Sbjct: 81 LPSNLYTCKSLVILELCGEIRLDVPRMAFLPSLKTLQLHSVRYLNEDSLHRLLSNCPVLE 140 Query: 507 NLAVRRSNFITFNYREPLNIFVPNLKHLSLLFMHSYKKTD--ISAPNLKQF 361 +L V + + + E L + VP+L+ LSL HSY+ I P+LK F Sbjct: 141 DLLV---DLLLSDSMEKLTVVVPSLQILSLFIPHSYEIDGIVIETPSLKYF 188 >dbj|BAD95186.1| hypothetical protein [Arabidopsis thaliana] Length = 246 Score = 69.7 bits (169), Expect = 6e-10 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 3/111 (2%) Frame = -2 Query: 684 LSGGLFTCISLTSLTLENFV-LDLPRTVGFPLLKTLKLDHVTIPSENLINKLFSNCPVLE 508 L L+TC SL L L + LD+PR P LKTL+L V +E+ +++L SNCPVLE Sbjct: 81 LPSNLYTCKSLVILELCGEIRLDVPRMAFLPSLKTLQLHSVRYLNEDSLHRLLSNCPVLE 140 Query: 507 NLAVRRSNFITFNYREPLNIFVPNLKHLSLLFMHSYKKTD--ISAPNLKQF 361 +L V + + + E L + VP+L+ LSL HSY+ I P+LK F Sbjct: 141 DLLV---DLLLSDSMEKLTVVVPSLQILSLFIPHSYEIDGIVIETPSLKYF 188 >emb|CAB41093.1| putative protein [Arabidopsis thaliana] Length = 320 Score = 69.7 bits (169), Expect = 6e-10 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 3/111 (2%) Frame = -2 Query: 684 LSGGLFTCISLTSLTLENFV-LDLPRTVGFPLLKTLKLDHVTIPSENLINKLFSNCPVLE 508 L L+TC SL L L + LD+PR P LKTL+L V +E+ +++L SNCPVLE Sbjct: 28 LPSNLYTCKSLVILELCGEIRLDVPRMAFLPSLKTLQLHSVRYLNEDSLHRLLSNCPVLE 87 Query: 507 NLAVRRSNFITFNYREPLNIFVPNLKHLSLLFMHSYKKTD--ISAPNLKQF 361 +L V + + + E L + VP+L+ LSL HSY+ I P+LK F Sbjct: 88 DLLV---DLLLSDSMEKLTVVVPSLQILSLFIPHSYEIDGIVIETPSLKYF 135 >ref|NP_200481.1| FBD / Leucine Rich Repeat domains containing protein [Arabidopsis thaliana] gi|332009414|gb|AED96797.1| FBD / Leucine Rich Repeat domains containing protein [Arabidopsis thaliana] Length = 360 Score = 67.8 bits (164), Expect = 2e-09 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%) Frame = -2 Query: 747 AVDHNVPNLCIHGVSTKDAAELSGGLFTCISLTSLTL--ENFVLDLPRTVGFPLLKTLKL 574 AV V L I T A L L+TC SL +L L + +LD+PRTV P LKTL+L Sbjct: 59 AVSRCVRELSISLHDTTAAVSLPSSLYTCKSLVTLKLYGKKVLLDVPRTVFLPSLKTLQL 118 Query: 573 DHVTIPSENLINKLFSNCPVLENLAVRRSNFITFNYREPLNIFVPNLKHLSLLFMHSYKK 394 + + E+ + L S CPVLE+L++ R + ++ L + VP+L+ LSL + Sbjct: 119 ERLRYSDEDSLRLLLSYCPVLEDLSIVRED---YDNLRALVVIVPSLQRLSLEIPGNCSS 175 Query: 393 TD--ISAPNLKQF 361 I P+LK F Sbjct: 176 DGYVIVTPSLKYF 188 >sp|Q9FJU2.2|FBD37_ARATH RecName: Full=Putative FBD-associated F-box protein At5g56700 Length = 398 Score = 67.8 bits (164), Expect = 2e-09 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%) Frame = -2 Query: 747 AVDHNVPNLCIHGVSTKDAAELSGGLFTCISLTSLTL--ENFVLDLPRTVGFPLLKTLKL 574 AV V L I T A L L+TC SL +L L + +LD+PRTV P LKTL+L Sbjct: 97 AVSRCVRELSISLHDTTAAVSLPSSLYTCKSLVTLKLYGKKVLLDVPRTVFLPSLKTLQL 156 Query: 573 DHVTIPSENLINKLFSNCPVLENLAVRRSNFITFNYREPLNIFVPNLKHLSLLFMHSYKK 394 + + E+ + L S CPVLE+L++ R + ++ L + VP+L+ LSL + Sbjct: 157 ERLRYSDEDSLRLLLSYCPVLEDLSIVRED---YDNLRALVVIVPSLQRLSLEIPGNCSS 213 Query: 393 TD--ISAPNLKQF 361 I P+LK F Sbjct: 214 DGYVIVTPSLKYF 226