BLASTX nr result
ID: Coptis25_contig00021146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021146 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB71692.1| cytosolic glutamine synthetase [Daucus carota] 58 3e-12 ref|XP_002263856.1| PREDICTED: glutamine synthetase cytosolic is... 59 5e-12 emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera] 59 5e-12 sp|P51119.1|GLNA2_VITVI RecName: Full=Glutamine synthetase cytos... 59 5e-12 gb|AAT39510.1| glutamine synthetase [Elaeagnus umbellata] 59 5e-12 >gb|AAB71692.1| cytosolic glutamine synthetase [Daucus carota] Length = 284 Score = 57.8 bits (138), Expect(2) = 3e-12 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 236 KGPYYCGVGADKAFGCDIVDSHYKACL 156 +GPYYCG+GADKAFG DIVD+HYKACL Sbjct: 82 QGPYYCGIGADKAFGRDIVDAHYKACL 108 Score = 38.5 bits (88), Expect(2) = 3e-12 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -2 Query: 166 KPAFYAGINISGINGEVMLGQVXXXXXXXXXXXXXXXXLVIIYIFYSSTEI 14 K YAGINISGINGEVM GQ V YI S TEI Sbjct: 105 KACLYAGINISGINGEVMPGQWEFQVGPVVGISAGDELWVARYILESITEI 155 >ref|XP_002263856.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Vitis vinifera] gi|296087096|emb|CBI33470.3| unnamed protein product [Vitis vinifera] Length = 356 Score = 58.9 bits (141), Expect(2) = 5e-12 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 236 KGPYYCGVGADKAFGCDIVDSHYKACL 156 +GPYYCG+GADKAFG DIVDSHYKACL Sbjct: 154 QGPYYCGIGADKAFGRDIVDSHYKACL 180 Score = 36.6 bits (83), Expect(2) = 5e-12 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 166 KPAFYAGINISGINGEVMLGQ 104 K YAGINISGINGEVM GQ Sbjct: 177 KACLYAGINISGINGEVMPGQ 197 >emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera] Length = 356 Score = 58.9 bits (141), Expect(2) = 5e-12 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 236 KGPYYCGVGADKAFGCDIVDSHYKACL 156 +GPYYCG+GADKAFG DIVDSHYKACL Sbjct: 154 QGPYYCGIGADKAFGRDIVDSHYKACL 180 Score = 36.6 bits (83), Expect(2) = 5e-12 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 166 KPAFYAGINISGINGEVMLGQ 104 K YAGINISGINGEVM GQ Sbjct: 177 KACLYAGINISGINGEVMPGQ 197 >sp|P51119.1|GLNA2_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 2; AltName: Full=Glutamate--ammonia ligase gi|1134898|emb|CAA63982.1| glutamine synthetase [Vitis vinifera] Length = 356 Score = 58.9 bits (141), Expect(2) = 5e-12 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 236 KGPYYCGVGADKAFGCDIVDSHYKACL 156 +GPYYCG+GADKAFG DIVDSHYKACL Sbjct: 154 QGPYYCGIGADKAFGRDIVDSHYKACL 180 Score = 36.6 bits (83), Expect(2) = 5e-12 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 166 KPAFYAGINISGINGEVMLGQ 104 K YAGINISGINGEVM GQ Sbjct: 177 KACLYAGINISGINGEVMPGQ 197 >gb|AAT39510.1| glutamine synthetase [Elaeagnus umbellata] Length = 355 Score = 59.3 bits (142), Expect(2) = 5e-12 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 236 KGPYYCGVGADKAFGCDIVDSHYKACL 156 +GPYYCGVGADKAFG DIVDSHYKACL Sbjct: 153 QGPYYCGVGADKAFGRDIVDSHYKACL 179 Score = 36.2 bits (82), Expect(2) = 5e-12 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 166 KPAFYAGINISGINGEVMLGQ 104 K YAG+NISGINGEVM GQ Sbjct: 176 KACLYAGVNISGINGEVMPGQ 196