BLASTX nr result
ID: Coptis25_contig00021120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00021120 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30833.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002272240.1| PREDICTED: pentatricopeptide repeat-containi... 58 7e-07 emb|CAN64870.1| hypothetical protein VITISV_041329 [Vitis vinifera] 58 7e-07 emb|CAN82303.1| hypothetical protein VITISV_013933 [Vitis vinifera] 57 1e-06 ref|XP_003559712.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >emb|CBI30833.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -1 Query: 523 CSWVELKSGVHRFGMEDRTHPASNHLYSELDALTGNLFAYGYTPDV 386 CSW+ELK+GVH F DR HP ++ +Y+ L++LT L +GY PDV Sbjct: 584 CSWIELKNGVHVFVSADRAHPEAHSIYAGLNSLTARLREHGYVPDV 629 >ref|XP_002272240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14730-like [Vitis vinifera] Length = 629 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -1 Query: 523 CSWVELKSGVHRFGMEDRTHPASNHLYSELDALTGNLFAYGYTPDV 386 CSW+ELK+GVH F DR HP ++ +Y+ L++LT L +GY PDV Sbjct: 584 CSWIELKNGVHVFVSADRAHPEAHSIYAGLNSLTARLREHGYVPDV 629 >emb|CAN64870.1| hypothetical protein VITISV_041329 [Vitis vinifera] Length = 629 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -1 Query: 523 CSWVELKSGVHRFGMEDRTHPASNHLYSELDALTGNLFAYGYTPDV 386 CSW+ELK+GVH F DR HP + +Y+ L++LT L +GY PDV Sbjct: 584 CSWIELKNGVHVFVSADRAHPEAXSIYAGLNSLTARLXEHGYVPDV 629 >emb|CAN82303.1| hypothetical protein VITISV_013933 [Vitis vinifera] Length = 549 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -1 Query: 523 CSWVELKSGVHRFGMEDRTHPASNHLYSELDALTGNLFAYGYTPDV 386 CSW+ELK+GVH F DR HP + +Y+ L++LT L +GY PDV Sbjct: 504 CSWIELKNGVHVFVSADRAHPEAYSIYAGLNSLTARLCEHGYVPDV 549 >ref|XP_003559712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Brachypodium distachyon] Length = 650 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/45 (46%), Positives = 30/45 (66%) Frame = -1 Query: 520 SWVELKSGVHRFGMEDRTHPASNHLYSELDALTGNLFAYGYTPDV 386 SW+E+ HRFG++DR+HP S +Y LD L G++ GY PD+ Sbjct: 519 SWIEISQRTHRFGVDDRSHPISREIYRNLDRLIGSIKVAGYVPDI 563