BLASTX nr result
ID: Coptis25_contig00020909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00020909 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL79042.1|AF469649_1 NIMA-related protein kinase [Populus tr... 46 4e-09 ref|XP_002328349.1| predicted protein [Populus trichocarpa] gi|2... 46 7e-09 gb|ABK95214.1| unknown [Populus trichocarpa] 46 7e-09 ref|XP_002512228.1| ATP binding protein, putative [Ricinus commu... 46 3e-08 dbj|BAK03787.1| predicted protein [Hordeum vulgare subsp. vulgare] 47 3e-08 >gb|AAL79042.1|AF469649_1 NIMA-related protein kinase [Populus tremula x Populus alba] Length = 621 Score = 46.2 bits (108), Expect(2) = 4e-09 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 190 DMQGLINKINKSIVAPLPTLYSGA 261 DMQ LINKINKSIVAPLPT YSGA Sbjct: 207 DMQALINKINKSIVAPLPTKYSGA 230 Score = 39.3 bits (90), Expect(2) = 4e-09 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = +3 Query: 264 AADLLRHPHLQPYVLQVPILPGF*NQVAIPF 356 AA+LLRHPHLQPYVL++ I Q +PF Sbjct: 249 AAELLRHPHLQPYVLKIHIKMNSPRQNTLPF 279 >ref|XP_002328349.1| predicted protein [Populus trichocarpa] gi|222838064|gb|EEE76429.1| predicted protein [Populus trichocarpa] Length = 620 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 190 DMQGLINKINKSIVAPLPTLYSGA 261 DMQ LINKINKSIVAPLPT YSGA Sbjct: 207 DMQALINKINKSIVAPLPTKYSGA 230 Score = 38.5 bits (88), Expect(2) = 7e-09 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 264 AADLLRHPHLQPYVLQVPILPGF*NQVAIPF 356 AA+LLRHPHLQPYVL++ + Q +PF Sbjct: 249 AAELLRHPHLQPYVLKIHLKMNSPRQNTLPF 279 >gb|ABK95214.1| unknown [Populus trichocarpa] Length = 395 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 190 DMQGLINKINKSIVAPLPTLYSGA 261 DMQ LINKINKSIVAPLPT YSGA Sbjct: 207 DMQALINKINKSIVAPLPTKYSGA 230 Score = 38.5 bits (88), Expect(2) = 7e-09 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 264 AADLLRHPHLQPYVLQVPILPGF*NQVAIPF 356 AA+LLRHPHLQPYVL++ + Q +PF Sbjct: 249 AAELLRHPHLQPYVLKIHLKMNSPRQNTLPF 279 >ref|XP_002512228.1| ATP binding protein, putative [Ricinus communis] gi|223548189|gb|EEF49680.1| ATP binding protein, putative [Ricinus communis] Length = 608 Score = 46.2 bits (108), Expect(2) = 3e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 190 DMQGLINKINKSIVAPLPTLYSGA 261 DMQ LINKINKSIVAPLPT YSGA Sbjct: 207 DMQALINKINKSIVAPLPTKYSGA 230 Score = 36.6 bits (83), Expect(2) = 3e-08 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = +3 Query: 264 AADLLRHPHLQPYVLQVPI 320 AA+LLRHPHLQPYVL+V + Sbjct: 249 AAELLRHPHLQPYVLKVQL 267 >dbj|BAK03787.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 508 Score = 46.6 bits (109), Expect(2) = 3e-08 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 190 DMQGLINKINKSIVAPLPTLYSGA 261 DMQ LINKINKS+VAPLPT+YSGA Sbjct: 128 DMQTLINKINKSVVAPLPTIYSGA 151 Score = 36.2 bits (82), Expect(2) = 3e-08 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 264 AADLLRHPHLQPYVLQV 314 AADLL HPHLQPYVL+V Sbjct: 170 AADLLNHPHLQPYVLEV 186