BLASTX nr result
ID: Coptis25_contig00020901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00020901 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002530545.1| protein binding protein, putative [Ricinus c... 85 7e-15 ref|XP_002330854.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 emb|CBI30079.3| unnamed protein product [Vitis vinifera] 73 2e-11 dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] 73 3e-11 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/74 (51%), Positives = 47/74 (63%) Frame = -3 Query: 226 GKLEYDQSIEHFSHEHPLELSKFKELPQNFPSTCSGCNLSCSDWLYTCKACKYVLHILCS 47 GKL +D I HFSH HPLELS + L N +CS CNL S W+Y+CK C + LHI C+ Sbjct: 2 GKLNHDPYINHFSHPHPLELSNAQSLYMN---SCSACNLQPSGWMYSCKPCNFTLHISCT 58 Query: 46 QVPQFLHHPADPNH 5 Q+P + HP P H Sbjct: 59 QMPTLITHPCHPIH 72 >ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Length = 324 Score = 84.7 bits (208), Expect = 7e-15 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -3 Query: 226 GKLEYDQSIEHFSHEHPLELSKFKELPQNFPST-CSGCNLSCSDWLYTCKACKYVLHILC 50 G+L +D I HFSH HPL LS L ++P T CS C L S W+Y+C C + LH+ C Sbjct: 2 GRLSHDPCIHHFSHPHPLHLSN---LQSSYPITHCSACQLESSGWMYSCNPCNFTLHLSC 58 Query: 49 SQVPQFLHHPADPNH 5 SQ+P + HP+ PNH Sbjct: 59 SQLPSLITHPSHPNH 73 >ref|XP_002330854.1| predicted protein [Populus trichocarpa] gi|222872676|gb|EEF09807.1| predicted protein [Populus trichocarpa] Length = 321 Score = 80.5 bits (197), Expect = 1e-13 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = -3 Query: 211 DQSIEHFSHEHPLELSKFKELPQNFPSTCSGCNLSCSDWLYTCKACKYVLHILCSQVPQF 32 + +I+HFSH HPL+LS ++ ++CSGC L S W+Y C C Y LH+ CSQ+PQ Sbjct: 9 EAAIQHFSHPHPLQLSNYQPQQTLCLASCSGCKLKISGWIYACTQCNYFLHVSCSQMPQQ 68 Query: 31 LHHPADPNH 5 + HP NH Sbjct: 69 ITHPYHQNH 77 >emb|CBI30079.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 73.2 bits (178), Expect = 2e-11 Identities = 38/79 (48%), Positives = 47/79 (59%), Gaps = 5/79 (6%) Frame = -3 Query: 226 GKLEYDQ--SIEHFSHEHPLELSKFKELPQNFPSTCSGCNLSC---SDWLYTCKACKYVL 62 GKL ++ HFSHEHPLEL+ PQ + CSGC +S D+ YTCK C Y L Sbjct: 2 GKLSIEEMRDFSHFSHEHPLELTNL--WPQGH-TVCSGCKMSIVAGKDY-YTCKPCSYYL 57 Query: 61 HILCSQVPQFLHHPADPNH 5 H C +P+ + HPADPNH Sbjct: 58 HSTCYNLPRLIQHPADPNH 76 >dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] Length = 212 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/71 (43%), Positives = 40/71 (56%) Frame = -3 Query: 217 EYDQSIEHFSHEHPLELSKFKELPQNFPSTCSGCNLSCSDWLYTCKACKYVLHILCSQVP 38 E +I HFSH HPLEL + + CSGC + +YTCK+C + LH CSQ+P Sbjct: 10 ESKNTINHFSHPHPLELITNQNFASSSSQLCSGCKIQAIGSIYTCKSCNFFLHTECSQMP 69 Query: 37 QFLHHPADPNH 5 Q + HP D H Sbjct: 70 QQITHPFDKEH 80