BLASTX nr result
ID: Coptis25_contig00020540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00020540 (708 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534534.1| NAC domain-containing protein, putative [Ric... 58 2e-06 gb|AAT38710.2| no apical meristem, identical [Solanum demissum] 39 5e-06 gb|AAT39970.1| Putative nam-like protein, identical [Solanum dem... 39 5e-06 >ref|XP_002534534.1| NAC domain-containing protein, putative [Ricinus communis] gi|223525097|gb|EEF27849.1| NAC domain-containing protein, putative [Ricinus communis] Length = 399 Score = 58.2 bits (139), Expect = 2e-06 Identities = 46/135 (34%), Positives = 61/135 (45%), Gaps = 18/135 (13%) Frame = -3 Query: 352 SGDHQNCSTLSSVHVCCFLERQSSQGDQN*LGKHMFRLTSVTGLTPPKKHIGKSFPANNT 173 S D C L V F ++++G + H FRL SV +PPKK + KS P N+ Sbjct: 107 SSDGTKCIGLKKSLV--FYRGRAAKGMKTDWMMHEFRLPSVAEPSPPKKFLDKSLPPNDA 164 Query: 172 -------KKCSKLHGTESSHSWASPFPEMAASDI-------ALH*VPRTHPQ----TEAG 47 KK + + +HSW + PE A DI A H + TE G Sbjct: 165 WAICRIFKKTNSMAQRALNHSWITQLPETTAPDILNQGAAAAGHCTQYSSENISCTTEIG 224 Query: 46 LVFQLC*NNDLQQSS 2 VFQ+C N DLQQ+S Sbjct: 225 SVFQICSNTDLQQAS 239 >gb|AAT38710.2| no apical meristem, identical [Solanum demissum] Length = 363 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -1 Query: 390 NSLKPSRVSGAGFLETTRTVPRYHPYMSVVF*RGRAAKGIKTDW 259 NS +P+RV+GAGF + T GRAAKGIKTDW Sbjct: 73 NSARPNRVTGAGFWKAT----------------GRAAKGIKTDW 100 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 7/52 (13%) Frame = -3 Query: 253 HMFRLTSVTGLTPPKKHIGKSFPANNT-------KKCSKLHGTESSHSWASP 119 H FRL S+T T PK+ + K P N++ KK + SHSW SP Sbjct: 103 HEFRLPSITDSTAPKRFLDKHIPPNDSWAICRIFKKANSNAHRALSHSWVSP 154 >gb|AAT39970.1| Putative nam-like protein, identical [Solanum demissum] Length = 363 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -1 Query: 390 NSLKPSRVSGAGFLETTRTVPRYHPYMSVVF*RGRAAKGIKTDW 259 NS +P+RV+GAGF + T GRAAKGIKTDW Sbjct: 73 NSARPNRVTGAGFWKAT----------------GRAAKGIKTDW 100 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 7/52 (13%) Frame = -3 Query: 253 HMFRLTSVTGLTPPKKHIGKSFPANNT-------KKCSKLHGTESSHSWASP 119 H FRL S+T T PK+ + K P N++ KK + SHSW SP Sbjct: 103 HEFRLPSITDSTAPKRFLDKHIPPNDSWAICRIFKKANSNAHRALSHSWVSP 154