BLASTX nr result
ID: Coptis25_contig00020327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00020327 (613 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34372.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002273245.1| PREDICTED: putative phosphoglycerate mutase ... 62 1e-07 >emb|CBI34372.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 3 EWQKYAKPGELNYDCSTTGPAFFTHFNSEDRKT 101 EWQK AKPGELNYDC TGP+FFTHF ED +T Sbjct: 322 EWQKIAKPGELNYDCLITGPSFFTHFEDEDNET 354 >ref|XP_002273245.1| PREDICTED: putative phosphoglycerate mutase DET1 [Vitis vinifera] Length = 339 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 3 EWQKYAKPGELNYDCSTTGPAFFTHFNSEDRKT 101 EWQK AKPGELNYDC TGP+FFTHF ED +T Sbjct: 307 EWQKIAKPGELNYDCLITGPSFFTHFEDEDNET 339