BLASTX nr result
ID: Coptis25_contig00019995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019995 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW82049.1| putative seven in absentia domain family protein ... 67 2e-09 gb|AFW77508.1| putative seven in absentia domain family protein ... 67 2e-09 gb|AFW77506.1| putative seven in absentia domain family protein ... 67 2e-09 ref|XP_003566405.1| PREDICTED: E3 ubiquitin-protein ligase SINAT... 67 2e-09 ref|XP_002440840.1| hypothetical protein SORBIDRAFT_09g008090 [S... 67 2e-09 >gb|AFW82049.1| putative seven in absentia domain family protein [Zea mays] Length = 349 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 GDRKELKLRVTGRIWKEQQNPDGVCIPNLCS 93 GDRKELKLRVTGRIWKEQ NPDG CIPNLCS Sbjct: 319 GDRKELKLRVTGRIWKEQTNPDGACIPNLCS 349 >gb|AFW77508.1| putative seven in absentia domain family protein [Zea mays] Length = 100 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 GDRKELKLRVTGRIWKEQQNPDGVCIPNLCS 93 GDRKELKLRVTGRIWKEQ NPDG CIPNLCS Sbjct: 70 GDRKELKLRVTGRIWKEQTNPDGACIPNLCS 100 >gb|AFW77506.1| putative seven in absentia domain family protein [Zea mays] Length = 327 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 GDRKELKLRVTGRIWKEQQNPDGVCIPNLCS 93 GDRKELKLRVTGRIWKEQ NPDG CIPNLCS Sbjct: 297 GDRKELKLRVTGRIWKEQTNPDGACIPNLCS 327 >ref|XP_003566405.1| PREDICTED: E3 ubiquitin-protein ligase SINAT3-like [Brachypodium distachyon] Length = 532 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 GDRKELKLRVTGRIWKEQQNPDGVCIPNLCS 93 GDRKELKLRVTGRIWKEQ NPDG CIPNLCS Sbjct: 502 GDRKELKLRVTGRIWKEQPNPDGTCIPNLCS 532 >ref|XP_002440840.1| hypothetical protein SORBIDRAFT_09g008090 [Sorghum bicolor] gi|241946125|gb|EES19270.1| hypothetical protein SORBIDRAFT_09g008090 [Sorghum bicolor] Length = 353 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 GDRKELKLRVTGRIWKEQQNPDGVCIPNLCS 93 GDRKELKLRVTGRIWKEQ NPDG CIPNLCS Sbjct: 323 GDRKELKLRVTGRIWKEQTNPDGACIPNLCS 353