BLASTX nr result
ID: Coptis25_contig00019875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019875 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 91 1e-16 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea m... 64 1e-08 ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 57 2e-06 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 90.9 bits (224), Expect = 1e-16 Identities = 50/69 (72%), Positives = 52/69 (75%), Gaps = 1/69 (1%) Frame = +1 Query: 121 YPILESSAELYPARISF*-RGPKKCLHLLPTVFLRNYTERVDPPLPFVLATYPKVSSPRA 297 YPILE SA L PA F + PKK LHLLPTVFL+N ERVDPP FVLATYPKVSS R Sbjct: 6 YPILEPSAGLNPAPPHFLLKRPKKGLHLLPTVFLQNLIERVDPPPHFVLATYPKVSSLRV 65 Query: 298 PRRRQSNQP 324 PRRRQ NQP Sbjct: 66 PRRRQKNQP 74 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 77.4 bits (189), Expect(2) = 1e-12 Identities = 41/56 (73%), Positives = 44/56 (78%) Frame = -2 Query: 328 RRVGCSVVAGELLARRP*DKLLKQTGGEDRPVQYNSEERLLAAGGDISLAPFKRKC 161 RRVG S+VAG+LL RRP LKQ G EDRPVQ N EERLLA GGD+SLA FKRKC Sbjct: 44 RRVGSSIVAGQLLVRRP--YFLKQKGEEDRPVQSNFEERLLAVGGDLSLALFKRKC 97 Score = 20.4 bits (41), Expect(2) = 1e-12 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 158 AG*SSAEDSRIG 123 AG SSAE SRIG Sbjct: 100 AGLSSAEGSRIG 111 >tpg|DAA47075.1| TPA: hypothetical protein ZEAMMB73_027346 [Zea mays] Length = 88 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 252 EGRIDPFSIIPKKDCWQQVETFLWPPSK 169 EGRIDPFS IPKKDCWQQVETFLWPPSK Sbjct: 61 EGRIDPFSRIPKKDCWQQVETFLWPPSK 88 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/51 (66%), Positives = 35/51 (68%) Frame = -1 Query: 257 NGRGGSTRSV*FRRKTVGSRWRHFFGPLQKEMRAG*SSAEDSRIG*VGSCP 105 +G GGSTRSV FRRKTVGSRWR FFGPLQKEMR VGSCP Sbjct: 36 DGGGGSTRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSCP 86 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 248 GGSTRSV*FRRKTVGSRWRHFFGPLQKE 165 GGSTRSV FRRKTVGSRWRHFFGPL+K+ Sbjct: 243 GGSTRSVEFRRKTVGSRWRHFFGPLKKK 270