BLASTX nr result
ID: Coptis25_contig00019823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019823 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB75401.1| IPK2 protein [Vitis vinifera] 70 2e-10 ref|XP_002279587.1| PREDICTED: inositol polyphosphate multikinas... 70 2e-10 gb|ABO72543.1| inositol polyphosphate multikinase [Solanum tuber... 69 4e-10 emb|CAC35322.1| hypothetical protein [Linum usitatissimum] 67 2e-09 ref|XP_002318190.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >gb|AFB75401.1| IPK2 protein [Vitis vinifera] Length = 305 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 203 EVKLVDFAHVVHDQGVIDHNFLGGLCSLIKFVSEILASP 87 E+KL+DFAHVV +GVIDHNFLGGLCSLIK +SEIL SP Sbjct: 242 EIKLIDFAHVVEGEGVIDHNFLGGLCSLIKMISEILTSP 280 >ref|XP_002279587.1| PREDICTED: inositol polyphosphate multikinase beta-like [Vitis vinifera] Length = 305 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 203 EVKLVDFAHVVHDQGVIDHNFLGGLCSLIKFVSEILASP 87 E+KL+DFAHVV +GVIDHNFLGGLCSLIK +SEIL SP Sbjct: 242 EIKLIDFAHVVEGEGVIDHNFLGGLCSLIKMISEILTSP 280 >gb|ABO72543.1| inositol polyphosphate multikinase [Solanum tuberosum] gi|134801255|emb|CAM12755.1| inositol polyphosphate multikinase [Solanum tuberosum] Length = 313 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 200 VKLVDFAHVVHDQGVIDHNFLGGLCSLIKFVSEILASPVD 81 +KL+DFAHV QGVIDHNFLGGLCSLIKF+S+IL +P D Sbjct: 243 IKLIDFAHVYEGQGVIDHNFLGGLCSLIKFISDILTAPSD 282 >emb|CAC35322.1| hypothetical protein [Linum usitatissimum] Length = 300 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 200 VKLVDFAHVVHDQGVIDHNFLGGLCSLIKFVSEILASP 87 VKL+DFAHV GVIDHNFLGGLCSLIKF+SEIL P Sbjct: 248 VKLIDFAHVTEGNGVIDHNFLGGLCSLIKFISEILTGP 285 >ref|XP_002318190.1| predicted protein [Populus trichocarpa] gi|222858863|gb|EEE96410.1| predicted protein [Populus trichocarpa] Length = 279 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 203 EVKLVDFAHVVHDQGVIDHNFLGGLCSLIKFVSEILAS 90 EVKL+DFAHV G+IDHNF+GGLCSLIKF+SEIL S Sbjct: 242 EVKLIDFAHVTEGNGIIDHNFVGGLCSLIKFISEILTS 279