BLASTX nr result
ID: Coptis25_contig00019303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019303 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBJ20761.1| hypothetical protein [Beta vulgaris subsp. marit... 82 3e-14 >emb|CBJ20761.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 135 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = -2 Query: 227 GPIHTSELVLPRSIYPSIFHFRTNPSYLNRYLSSISMAGRVWEES 93 GPIHTS LVLP SIYPSIFHF TNPSYLN YLSSISMA RVWEES Sbjct: 91 GPIHTSVLVLPGSIYPSIFHFGTNPSYLNPYLSSISMARRVWEES 135