BLASTX nr result
ID: Coptis25_contig00019273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019273 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518335.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 gb|AFW84902.1| putative lectin-domain receptor-like protein kina... 55 6e-06 ref|XP_003562911.1| PREDICTED: L-type lectin-domain containing r... 55 6e-06 ref|XP_002456443.1| hypothetical protein SORBIDRAFT_03g036370 [S... 55 6e-06 gb|ACL53102.1| unknown [Zea mays] gi|413952252|gb|AFW84901.1| pu... 55 6e-06 >ref|XP_002518335.1| conserved hypothetical protein [Ricinus communis] gi|223542555|gb|EEF44095.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +1 Query: 1 GTLDYMAPECVVTGKAGKESDVYS---VALEIACG 96 GTL YMAPECV+TGKA KESD+YS VALEIACG Sbjct: 86 GTLGYMAPECVITGKANKESDIYSFGIVALEIACG 120 >gb|AFW84902.1| putative lectin-domain receptor-like protein kinase family protein [Zea mays] Length = 705 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +1 Query: 1 GTLDYMAPECVVTGKAGKESDVYS---VALEIACG 96 GTL Y+APECV+TGKA +ESDVYS VALEIACG Sbjct: 536 GTLGYLAPECVMTGKASRESDVYSFGVVALEIACG 570 >ref|XP_003562911.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Brachypodium distachyon] Length = 690 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 3/35 (8%) Frame = +1 Query: 1 GTLDYMAPECVVTGKAGKESDVYS---VALEIACG 96 GT+ YMAPECV TGKA KESDVYS +ALEIACG Sbjct: 510 GTMGYMAPECVTTGKASKESDVYSFGILALEIACG 544 >ref|XP_002456443.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] gi|241928418|gb|EES01563.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] Length = 680 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +1 Query: 1 GTLDYMAPECVVTGKAGKESDVYS---VALEIACG 96 GTL Y+APECV+TGKA +ESDVYS VALEIACG Sbjct: 512 GTLGYLAPECVMTGKASRESDVYSFGVVALEIACG 546 >gb|ACL53102.1| unknown [Zea mays] gi|413952252|gb|AFW84901.1| putative lectin-domain receptor-like protein kinase family protein [Zea mays] Length = 679 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +1 Query: 1 GTLDYMAPECVVTGKAGKESDVYS---VALEIACG 96 GTL Y+APECV+TGKA +ESDVYS VALEIACG Sbjct: 510 GTLGYLAPECVMTGKASRESDVYSFGVVALEIACG 544