BLASTX nr result
ID: Coptis25_contig00019217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019217 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526064.1| rotamase, putative [Ricinus communis] gi|223... 115 3e-24 ref|XP_004140193.1| PREDICTED: rhodanese-like/PpiC domain-contai... 114 6e-24 ref|XP_002276538.1| PREDICTED: UPF0176 protein Pput_3956 [Vitis ... 112 2e-23 emb|CAN74567.1| hypothetical protein VITISV_015712 [Vitis vinifera] 112 2e-23 gb|AFK46514.1| unknown [Medicago truncatula] 112 3e-23 >ref|XP_002526064.1| rotamase, putative [Ricinus communis] gi|223534645|gb|EEF36341.1| rotamase, putative [Ricinus communis] Length = 294 Score = 115 bits (289), Expect = 3e-24 Identities = 54/68 (79%), Positives = 62/68 (91%) Frame = -1 Query: 206 REIMVQHLLVNESNLNLIVELQQKILGGEDLSDLATEHSICPSKQQGGMLGWVRKGQMVP 27 REI+VQHLLV E +L L+VELQQ+I GGEDLSDLA ++SICPSK +GGMLGWVRKG+MVP Sbjct: 87 REILVQHLLVKEDDLKLLVELQQRIAGGEDLSDLAVDYSICPSKAEGGMLGWVRKGEMVP 146 Query: 26 EFEEAAFN 3 EFEEAAFN Sbjct: 147 EFEEAAFN 154 >ref|XP_004140193.1| PREDICTED: rhodanese-like/PpiC domain-containing protein 12-like [Cucumis sativus] Length = 252 Score = 114 bits (286), Expect = 6e-24 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = -1 Query: 206 REIMVQHLLVNESNLNLIVELQQKILGGEDLSDLATEHSICPSKQQGGMLGWVRKGQMVP 27 RE++VQHLLV E ++ L+ ELQQ+I GGEDLSDLA E+S+CPSK++GGMLGWVRKGQMVP Sbjct: 85 RELLVQHLLVKEDDIKLLSELQQRIAGGEDLSDLAVEYSLCPSKEEGGMLGWVRKGQMVP 144 Query: 26 EFEEAAFN 3 EFEEAAFN Sbjct: 145 EFEEAAFN 152 >ref|XP_002276538.1| PREDICTED: UPF0176 protein Pput_3956 [Vitis vinifera] gi|296083867|emb|CBI24255.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 112 bits (281), Expect = 2e-23 Identities = 53/67 (79%), Positives = 61/67 (91%) Frame = -1 Query: 206 REIMVQHLLVNESNLNLIVELQQKILGGEDLSDLATEHSICPSKQQGGMLGWVRKGQMVP 27 REI+VQHLLV E +L L++ELQQ+I GG DLSDLA E+SICPSK++GGMLGWVRKGQMVP Sbjct: 89 REILVQHLLVKEDDLKLLLELQQRISGGVDLSDLAVEYSICPSKEEGGMLGWVRKGQMVP 148 Query: 26 EFEEAAF 6 EFEEAAF Sbjct: 149 EFEEAAF 155 >emb|CAN74567.1| hypothetical protein VITISV_015712 [Vitis vinifera] Length = 241 Score = 112 bits (281), Expect = 2e-23 Identities = 53/67 (79%), Positives = 61/67 (91%) Frame = -1 Query: 206 REIMVQHLLVNESNLNLIVELQQKILGGEDLSDLATEHSICPSKQQGGMLGWVRKGQMVP 27 REI+VQHLLV E +L L++ELQQ+I GG DLSDLA E+SICPSK++GGMLGWVRKGQMVP Sbjct: 89 REILVQHLLVKEDDLKLLLELQQRISGGVDLSDLAVEYSICPSKEEGGMLGWVRKGQMVP 148 Query: 26 EFEEAAF 6 EFEEAAF Sbjct: 149 EFEEAAF 155 >gb|AFK46514.1| unknown [Medicago truncatula] Length = 291 Score = 112 bits (280), Expect = 3e-23 Identities = 52/68 (76%), Positives = 60/68 (88%) Frame = -1 Query: 206 REIMVQHLLVNESNLNLIVELQQKILGGEDLSDLATEHSICPSKQQGGMLGWVRKGQMVP 27 REI+VQHLLV E + L+V+LQQ++ GEDLSDLA EHSICPSK +GGMLGWVRKGQMVP Sbjct: 84 REILVQHLLVKEDDPKLLVDLQQRVAAGEDLSDLAVEHSICPSKDEGGMLGWVRKGQMVP 143 Query: 26 EFEEAAFN 3 EFEEAAF+ Sbjct: 144 EFEEAAFS 151