BLASTX nr result
ID: Coptis25_contig00019173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019173 (880 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum... 84 4e-19 gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] 92 2e-16 ref|YP_004564089.1| ATP synthase CF0 subunit I [Nelumbo nucifera... 92 2e-16 ref|YP_004563853.1| ATP synthase CF0 subunit I [Nelumbo lutea] g... 92 2e-16 ref|YP_001294084.1| ATP synthase CF0 subunit I [Chloranthus spic... 92 2e-16 >gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum] gi|224351|prf||1102209E ORF 5 Length = 162 Score = 84.3 bits (207), Expect(2) = 4e-19 Identities = 42/53 (79%), Positives = 50/53 (94%) Frame = -3 Query: 161 RKQIILSTIRNSEELRGGAIEKLEKAKARLWKVKMEADEFRVNGYSEIEREKV 3 RKQ IL+TIRNSEELRGGAIE+LEKA++RL KV+ EA++FRVNGYSEIEREK+ Sbjct: 34 RKQRILNTIRNSEELRGGAIEQLEKARSRLRKVESEAEQFRVNGYSEIEREKL 86 Score = 37.0 bits (84), Expect(2) = 4e-19 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 259 MNRKIHVWFGKRSWNF 212 MNRKIHVWFGK WNF Sbjct: 1 MNRKIHVWFGKGLWNF 16 >gb|AAZ03832.1| ATP synthase CF0 B chain [Ranunculus macranthus] Length = 188 Score = 91.7 bits (226), Expect = 2e-16 Identities = 48/52 (92%), Positives = 48/52 (92%) Frame = -3 Query: 161 RKQIILSTIRNSEELRGGAIEKLEKAKARLWKVKMEADEFRVNGYSEIEREK 6 RKQ ILSTIRNSEELRGGAIEKLEKAKARL KVK EADEFR NGYSEIEREK Sbjct: 61 RKQRILSTIRNSEELRGGAIEKLEKAKARLRKVKAEADEFRTNGYSEIEREK 112 >ref|YP_004564089.1| ATP synthase CF0 subunit I [Nelumbo nucifera] gi|224474208|gb|ACN49394.1| ATP synthase CF0 subunit I [Nelumbo nucifera] gi|383286783|gb|AFH01433.1| ATP synthase CF0 subunit I (chloroplast) [Nelumbo nucifera] Length = 189 Score = 91.7 bits (226), Expect = 2e-16 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 161 RKQIILSTIRNSEELRGGAIEKLEKAKARLWKVKMEADEFRVNGYSEIEREKV 3 RKQ ILSTIRNSEELRGGAIE+LEKA+ARL KV+MEADEFRVNGYSEIEREK+ Sbjct: 61 RKQRILSTIRNSEELRGGAIEQLEKARARLRKVEMEADEFRVNGYSEIEREKL 113 >ref|YP_004563853.1| ATP synthase CF0 subunit I [Nelumbo lutea] gi|224474120|gb|ACN49309.1| ATP synthase CF0 subunit I [Nelumbo lutea] gi|290490230|gb|ADD31522.1| ATP synthase CF0 subunit I protein [Nelumbo nucifera] gi|383286866|gb|AFH01515.1| ATP synthase CF0 subunit I (chloroplast) [Nelumbo lutea] Length = 184 Score = 91.7 bits (226), Expect = 2e-16 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 161 RKQIILSTIRNSEELRGGAIEKLEKAKARLWKVKMEADEFRVNGYSEIEREKV 3 RKQ ILSTIRNSEELRGGAIE+LEKA+ARL KV+MEADEFRVNGYSEIEREK+ Sbjct: 56 RKQRILSTIRNSEELRGGAIEQLEKARARLRKVEMEADEFRVNGYSEIEREKL 108 >ref|YP_001294084.1| ATP synthase CF0 subunit I [Chloranthus spicatus] gi|226741337|sp|A6MMA8.1|ATPF_CHLSC RecName: Full=ATP synthase subunit b, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit b; AltName: Full=ATPase subunit I gi|146744174|gb|ABQ43246.1| ATP synthase CF0 subunit I [Chloranthus spicatus] Length = 184 Score = 91.7 bits (226), Expect = 2e-16 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 161 RKQIILSTIRNSEELRGGAIEKLEKAKARLWKVKMEADEFRVNGYSEIEREKV 3 RKQ ILSTIRNSEELRGGAIE+LEKA+ARL KV+MEADEFRVNGYSEIERE+V Sbjct: 56 RKQRILSTIRNSEELRGGAIEQLEKARARLRKVEMEADEFRVNGYSEIERERV 108