BLASTX nr result
ID: Coptis25_contig00019104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00019104 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana] 56 3e-06 ref|NP_001031340.1| proteasome subunit alpha type-6-B [Arabidops... 56 3e-06 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha ty... 56 3e-06 emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome... 56 3e-06 gb|ADJ95344.1| PAA1 [Carica papaya] 56 3e-06 >gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana] Length = 246 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 173 KYAFKKVKLAGITSIGVRGKDSVCVITQKK 84 +YAFK VK AGITSIGVRGKDSVCV+TQKK Sbjct: 26 EYAFKAVKTAGITSIGVRGKDSVCVVTQKK 55 >ref|NP_001031340.1| proteasome subunit alpha type-6-B [Arabidopsis thaliana] gi|330250886|gb|AEC05980.1| proteasome subunit alpha type-6-B [Arabidopsis thaliana] Length = 220 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 173 KYAFKKVKLAGITSIGVRGKDSVCVITQKK 84 +YAFK VK AGITSIGVRGKDSVCV+TQKK Sbjct: 26 EYAFKAVKAAGITSIGVRGKDSVCVVTQKK 55 >sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1 gi|4539545|emb|CAB39975.1| PRCI [Nicotiana tabacum] Length = 246 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 173 KYAFKKVKLAGITSIGVRGKDSVCVITQKK 84 +YAFK VK AGITSIGVRGKDSVCV+TQKK Sbjct: 26 EYAFKAVKAAGITSIGVRGKDSVCVVTQKK 55 >emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha subunit [Arabidopsis thaliana] Length = 245 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 173 KYAFKKVKLAGITSIGVRGKDSVCVITQKK 84 +YAFK VK AGITSIGVRGKDSVCV+TQKK Sbjct: 25 EYAFKAVKTAGITSIGVRGKDSVCVVTQKK 54 >gb|ADJ95344.1| PAA1 [Carica papaya] Length = 246 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 173 KYAFKKVKLAGITSIGVRGKDSVCVITQKK 84 +YAFK VK AGITSIGVRGKDSVCV+TQKK Sbjct: 26 EYAFKAVKAAGITSIGVRGKDSVCVVTQKK 55