BLASTX nr result
ID: Coptis25_contig00018889
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00018889 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 86 3e-15 emb|CBI29825.3| unnamed protein product [Vitis vinifera] 82 6e-14 ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|NP_178072.1| pentatricopeptide repeat-containing protein [Ar... 74 9e-12 ref|XP_002889252.1| pentatricopeptide repeat-containing protein ... 74 9e-12 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 85.9 bits (211), Expect = 3e-15 Identities = 42/96 (43%), Positives = 66/96 (68%), Gaps = 4/96 (4%) Frame = +3 Query: 162 FSHIEFKLQQ----ILDLYDPIEQPLETIAPLHLTPNTITSLLVHNQSNVELSYRFFIWA 329 +S ++F + I+D +PIE LE+ P L+P+ +T ++ N N L +RFFIWA Sbjct: 25 YSAVDFAISNEVLTIIDSVNPIEPALESKVPF-LSPSIVT-YIIKNPPNSLLGFRFFIWA 82 Query: 330 MRKKDLRSWASHNLMIDMLVKNNGFDLAWKVIQELK 437 + + LRSW SHN++IDML+K+NGF+L W+V++E+K Sbjct: 83 SKFRRLRSWVSHNMIIDMLIKDNGFELYWQVLKEIK 118 >emb|CBI29825.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/100 (37%), Positives = 62/100 (62%) Frame = +3 Query: 138 SQFITKPRFSHIEFKLQQILDLYDPIEQPLETIAPLHLTPNTITSLLVHNQSNVELSYRF 317 + T + + I ++ +++ +P+E LE +AP + I + ++ Q EL +RF Sbjct: 26 ANLFTTAQGAAISNEVLTVMETVNPMEDALEKLAPF--LSSEIVNDVMREQRRPELGFRF 83 Query: 318 FIWAMRKKDLRSWASHNLMIDMLVKNNGFDLAWKVIQELK 437 FIW R++ RSW +HNL+IDML K++GFD WK+++ELK Sbjct: 84 FIWTTRRRSFRSWVTHNLVIDMLAKDDGFDTYWKILEELK 123 >ref|XP_002278530.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Vitis vinifera] Length = 798 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/100 (37%), Positives = 62/100 (62%) Frame = +3 Query: 138 SQFITKPRFSHIEFKLQQILDLYDPIEQPLETIAPLHLTPNTITSLLVHNQSNVELSYRF 317 + T + + I ++ +++ +P+E LE +AP + I + ++ Q EL +RF Sbjct: 26 ANLFTTAQGAAISNEVLTVMETVNPMEDALEKLAPF--LSSEIVNDVMREQRRPELGFRF 83 Query: 318 FIWAMRKKDLRSWASHNLMIDMLVKNNGFDLAWKVIQELK 437 FIW R++ RSW +HNL+IDML K++GFD WK+++ELK Sbjct: 84 FIWTTRRRSFRSWVTHNLVIDMLAKDDGFDTYWKILEELK 123 >ref|NP_178072.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200774|sp|Q9SAJ5.1|PP133_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79540 gi|4835755|gb|AAD30222.1|AC007202_4 Contains similarity to gi|2827663 F18F4.190 membrane-associated salt-inducible-like protein from Arabidopsis thaliana BAC gb|AL021637 [Arabidopsis thaliana] gi|332198140|gb|AEE36261.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 780 Score = 74.3 bits (181), Expect = 9e-12 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 11/117 (9%) Frame = +3 Query: 120 LIYKPISQFITKPRF-------SHIEFKLQ----QILDLYDPIEQPLETIAPLHLTPNTI 266 + ++ + QF +KP + + EF + IL PIE LE + P L+ N I Sbjct: 5 MFFRSVIQFYSKPSWMQRSYSSGNAEFNISGEVISILAKKKPIEPALEPLVPF-LSKNII 63 Query: 267 TSLLVHNQSNVELSYRFFIWAMRKKDLRSWASHNLMIDMLVKNNGFDLAWKVIQELK 437 TS+ + ++ N +L +RFFIWA R++ LRS S L+IDML ++NG DL W+ ++ELK Sbjct: 64 TSV-IKDEVNRQLGFRFFIWASRRERLRSRESFGLVIDMLSEDNGCDLYWQTLEELK 119 >ref|XP_002889252.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335093|gb|EFH65511.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 780 Score = 74.3 bits (181), Expect = 9e-12 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 11/117 (9%) Frame = +3 Query: 120 LIYKPISQFITKPRF-------SHIEFKLQ----QILDLYDPIEQPLETIAPLHLTPNTI 266 + ++ + QF +KP + + EF + IL PIE LE + P L+ N I Sbjct: 5 MFFRSVIQFYSKPSWMQRSYSSGNAEFNISGEVISILAKKKPIEPALEPLVPF-LSKNII 63 Query: 267 TSLLVHNQSNVELSYRFFIWAMRKKDLRSWASHNLMIDMLVKNNGFDLAWKVIQELK 437 TS+ + + N +L +RFFIWA R++ LRS S L+IDML ++NG DL W+ ++ELK Sbjct: 64 TSV-IKEEVNRQLGFRFFIWASRRERLRSGESFGLVIDMLSEDNGCDLYWQTLEELK 119