BLASTX nr result
ID: Coptis25_contig00018524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00018524 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37604.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002276832.1| PREDICTED: probable plastid-lipid-associated... 65 6e-09 emb|CAN60269.1| hypothetical protein VITISV_029394 [Vitis vinifera] 65 6e-09 ref|XP_002300202.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|NP_001031862.1| putative plastid-lipid-associated protein 7 ... 54 4e-06 >emb|CBI37604.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 65.1 bits (157), Expect = 6e-09 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 3 GIN--IFGVPSAKKSEIEDLVKLLESQNPTPHPTENLDKV 116 GIN +FGVPSAKKSEIE LVKLLESQNPTP PT NLDKV Sbjct: 83 GINRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKV 122 >ref|XP_002276832.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic [Vitis vinifera] Length = 285 Score = 65.1 bits (157), Expect = 6e-09 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 3 GIN--IFGVPSAKKSEIEDLVKLLESQNPTPHPTENLDKV 116 GIN +FGVPSAKKSEIE LVKLLESQNPTP PT NLDKV Sbjct: 108 GINRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKV 147 >emb|CAN60269.1| hypothetical protein VITISV_029394 [Vitis vinifera] Length = 233 Score = 65.1 bits (157), Expect = 6e-09 Identities = 34/40 (85%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +3 Query: 3 GIN--IFGVPSAKKSEIEDLVKLLESQNPTPHPTENLDKV 116 GIN +FGVPSAKKSEIE LVKLLESQNPTP PT NLDKV Sbjct: 104 GINRGVFGVPSAKKSEIEALVKLLESQNPTPEPTLNLDKV 143 >ref|XP_002300202.1| predicted protein [Populus trichocarpa] gi|222847460|gb|EEE85007.1| predicted protein [Populus trichocarpa] Length = 201 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 12 IFGVPSAKKSEIEDLVKLLESQNPTPHPTENLDKV 116 IFGVPSAKKS I LV+LLESQNPTP PT NL+KV Sbjct: 51 IFGVPSAKKSAILGLVELLESQNPTPDPTLNLEKV 85 >ref|NP_001031862.1| putative plastid-lipid-associated protein 7 [Arabidopsis thaliana] gi|75102996|sp|Q5M755.1|PAP7_ARATH RecName: Full=Probable plastid-lipid-associated protein 7, chloroplastic; AltName: Full=Fibrillin-7; Flags: Precursor gi|56461766|gb|AAV91339.1| At5g09820 [Arabidopsis thaliana] gi|110737316|dbj|BAF00604.1| hypothetical protein [Arabidopsis thaliana] gi|332004069|gb|AED91452.1| putative plastid-lipid-associated protein 7 [Arabidopsis thaliana] Length = 273 Score = 53.5 bits (127), Expect(2) = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +3 Query: 3 GIN--IFGVPSAKKSEIEDLVKLLESQNPTPHPTENLDKV 116 GIN IFGV S KK+EIE LVKLLE +NPTP PT LDK+ Sbjct: 96 GINRGIFGVKSDKKTEIEGLVKLLECRNPTPEPTGELDKI 135 Score = 21.9 bits (45), Expect(2) = 4e-06 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 Query: 181 KVGGCWK 201 K+GGCWK Sbjct: 134 KIGGCWK 140