BLASTX nr result
ID: Coptis25_contig00018264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00018264 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266803.1| PREDICTED: transcription factor VIP1-like [V... 75 7e-12 gb|AFO63283.1| bZIP4 [Tamarix hispida] 65 6e-09 gb|ABK96202.1| unknown [Populus trichocarpa] 62 5e-08 ref|XP_002535507.1| transcription factor, putative [Ricinus comm... 61 1e-07 ref|XP_002307491.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002266803.1| PREDICTED: transcription factor VIP1-like [Vitis vinifera] Length = 350 Score = 74.7 bits (182), Expect = 7e-12 Identities = 40/78 (51%), Positives = 49/78 (62%), Gaps = 2/78 (2%) Frame = -3 Query: 247 SNINNCIDIDGMPDTPKRGSHHRRAQSETFFRFPDDIIFDTDVDFNLS-SMDIIPSMSEE 71 S N DID MPD P RG+HHRRAQSETFFRF DDI+ D D D ++ ++DII + Sbjct: 13 SPFGNRADIDHMPDAPYRGAHHRRAQSETFFRFSDDILLDADADVDVDFNLDIISDNTNS 72 Query: 70 NVI-MTNVDDSGKSEESN 20 + DS KSE+SN Sbjct: 73 GAAGVPMAVDSSKSEDSN 90 >gb|AFO63283.1| bZIP4 [Tamarix hispida] Length = 347 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 7/75 (9%) Frame = -3 Query: 223 IDGMPDTPKRGSHHRRAQSETFFRFPDDIIFDTDVDFNLSSMDII-------PSMSEENV 65 ID +P+TP+R +HHRRA S+T FRFPDD++FD D +LSS+D++ P +E N Sbjct: 20 IDQIPETPQRAAHHRRAHSDTSFRFPDDLLFDVS-DVDLSSLDLLTTNHINSPPPTECNH 78 Query: 64 IMTNVDDSGKSEESN 20 + + DS KS+ES+ Sbjct: 79 VPMTL-DSSKSDESS 92 >gb|ABK96202.1| unknown [Populus trichocarpa] Length = 340 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -3 Query: 229 IDIDGMPDTPKRGSHHRRAQSETFFRFPDDIIFDTDVDFNLSSMDIIPS 83 +DI+ MP+TP RGSHHRRA S+T FRF DD++F DF+LSS+D +P+ Sbjct: 14 VDIEQMPETPYRGSHHRRAHSDTSFRF-DDLLFLDASDFDLSSLDDLPT 61 >ref|XP_002535507.1| transcription factor, putative [Ricinus communis] gi|223522845|gb|EEF26876.1| transcription factor, putative [Ricinus communis] Length = 283 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/50 (56%), Positives = 38/50 (76%) Frame = -3 Query: 241 INNCIDIDGMPDTPKRGSHHRRAQSETFFRFPDDIIFDTDVDFNLSSMDI 92 I +DI+ MPDTP+RGSHHRRA S+T FRF D ++FD D +LS++D+ Sbjct: 8 IGKMMDIEQMPDTPQRGSHHRRAHSDTSFRFDDLLLFDPS-DLDLSALDL 56 >ref|XP_002307491.1| predicted protein [Populus trichocarpa] gi|222856940|gb|EEE94487.1| predicted protein [Populus trichocarpa] Length = 330 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = -3 Query: 229 IDIDGMPDTPKRGSHHRRAQSETFFRFPDDIIFDTDVDFNLSSMDIIPS 83 +DI+ MP+TP RG+HHRRA S+T FRF D +IFD DF+L +D +P+ Sbjct: 3 VDIEQMPETPHRGNHHRRAHSDTSFRFDDLLIFDAS-DFDLPPLDDLPT 50