BLASTX nr result
ID: Coptis25_contig00018085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00018085 (653 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_568151.1| uncharacterized protein [Arabidopsis thaliana] ... 58 2e-06 dbj|BAB09965.1| unnamed protein product [Arabidopsis thaliana] 58 2e-06 ref|XP_002871145.1| hypothetical protein ARALYDRAFT_908428 [Arab... 56 7e-06 ref|XP_003615419.1| hypothetical protein MTR_5g067740 [Medicago ... 55 9e-06 >ref|NP_568151.1| uncharacterized protein [Arabidopsis thaliana] gi|17386124|gb|AAL38608.1|AF446875_1 AT5g05220/K18I23_2 [Arabidopsis thaliana] gi|15450647|gb|AAK96595.1| AT5g05220/K18I23_2 [Arabidopsis thaliana] gi|332003460|gb|AED90843.1| uncharacterized protein [Arabidopsis thaliana] Length = 182 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 370 AIMGEDEGREPNDYHRRAHIFDTCSRVFKSLKEE-DSVPVDY 492 AIMG D+GR+P DY+RRA IFD S++FK+L E+ D PVDY Sbjct: 97 AIMGNDDGRDPRDYNRRAKIFDKSSKIFKNLNEQRDQAPVDY 138 >dbj|BAB09965.1| unnamed protein product [Arabidopsis thaliana] Length = 205 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 370 AIMGEDEGREPNDYHRRAHIFDTCSRVFKSLKEE-DSVPVDY 492 AIMG D+GR+P DY+RRA IFD S++FK+L E+ D PVDY Sbjct: 120 AIMGNDDGRDPRDYNRRAKIFDKSSKIFKNLNEQRDQAPVDY 161 >ref|XP_002871145.1| hypothetical protein ARALYDRAFT_908428 [Arabidopsis lyrata subsp. lyrata] gi|297316982|gb|EFH47404.1| hypothetical protein ARALYDRAFT_908428 [Arabidopsis lyrata subsp. lyrata] Length = 183 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 370 AIMGEDEGREPNDYHRRAHIFDTCSRVFKSLKEE-DSVPVDY 492 AIMG+D+GR+P DY+RRA IFD S++FK+ KE+ D PV+Y Sbjct: 97 AIMGDDDGRDPTDYNRRAKIFDKSSKIFKNSKEQRDQSPVEY 138 >ref|XP_003615419.1| hypothetical protein MTR_5g067740 [Medicago truncatula] gi|355516754|gb|AES98377.1| hypothetical protein MTR_5g067740 [Medicago truncatula] Length = 150 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 370 AIMGEDEGREPNDYHRRAHIFDTCSRVFKSLKEED 474 AIMG+DEG+EPNDY+RRA IFD S+VF++LKE + Sbjct: 113 AIMGDDEGKEPNDYNRRAQIFDKSSQVFQALKESN 147