BLASTX nr result
ID: Coptis25_contig00017812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017812 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630344.1| hypothetical protein MTR_8g094540 [Medicago ... 88 8e-16 ref|XP_003602679.1| hypothetical protein MTR_3g096890 [Medicago ... 87 1e-15 ref|XP_003602676.1| hypothetical protein MTR_3g096890 [Medicago ... 87 1e-15 ref|XP_003602678.1| hypothetical protein MTR_3g096890 [Medicago ... 87 1e-15 ref|XP_003602677.1| hypothetical protein MTR_3g096890 [Medicago ... 87 1e-15 >ref|XP_003630344.1| hypothetical protein MTR_8g094540 [Medicago truncatula] gi|355524366|gb|AET04820.1| hypothetical protein MTR_8g094540 [Medicago truncatula] Length = 262 Score = 88.2 bits (217), Expect = 8e-16 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 560 DVVWYWFGKILATADLVYFSINLFVFLIPKFLPRSFERYFMERNEIYSKAAE 405 D W+WFG++LA A+LVYFSINLF FLIP+FLPR+F+RYF ER EIY+KAAE Sbjct: 189 DKAWFWFGRVLAVANLVYFSINLFGFLIPRFLPRAFKRYFQERGEIYAKAAE 240 >ref|XP_003602679.1| hypothetical protein MTR_3g096890 [Medicago truncatula] gi|355491727|gb|AES72930.1| hypothetical protein MTR_3g096890 [Medicago truncatula] Length = 262 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 560 DVVWYWFGKILATADLVYFSINLFVFLIPKFLPRSFERYFMERNEIYSKAAE 405 D WYWFGK LA A+L YFSINL VFLIP+FLPR+FERYF ER EIY+K+AE Sbjct: 193 DTAWYWFGKGLAVANLAYFSINLCVFLIPRFLPRAFERYFQERGEIYAKSAE 244 >ref|XP_003602676.1| hypothetical protein MTR_3g096890 [Medicago truncatula] gi|355491724|gb|AES72927.1| hypothetical protein MTR_3g096890 [Medicago truncatula] Length = 311 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 560 DVVWYWFGKILATADLVYFSINLFVFLIPKFLPRSFERYFMERNEIYSKAAE 405 D WYWFGK LA A+L YFSINL VFLIP+FLPR+FERYF ER EIY+K+AE Sbjct: 242 DTAWYWFGKGLAVANLAYFSINLCVFLIPRFLPRAFERYFQERGEIYAKSAE 293 >ref|XP_003602678.1| hypothetical protein MTR_3g096890 [Medicago truncatula] gi|355491726|gb|AES72929.1| hypothetical protein MTR_3g096890 [Medicago truncatula] Length = 333 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 560 DVVWYWFGKILATADLVYFSINLFVFLIPKFLPRSFERYFMERNEIYSKAAE 405 D WYWFGK LA A+L YFSINL VFLIP+FLPR+FERYF ER EIY+K+AE Sbjct: 264 DTAWYWFGKGLAVANLAYFSINLCVFLIPRFLPRAFERYFQERGEIYAKSAE 315 >ref|XP_003602677.1| hypothetical protein MTR_3g096890 [Medicago truncatula] gi|358348422|ref|XP_003638246.1| hypothetical protein MTR_122s0069 [Medicago truncatula] gi|355491725|gb|AES72928.1| hypothetical protein MTR_3g096890 [Medicago truncatula] gi|355504181|gb|AES85384.1| hypothetical protein MTR_122s0069 [Medicago truncatula] Length = 269 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 560 DVVWYWFGKILATADLVYFSINLFVFLIPKFLPRSFERYFMERNEIYSKAAE 405 D WYWFGK LA A+L YFSINL VFLIP+FLPR+FERYF ER EIY+K+AE Sbjct: 200 DTAWYWFGKGLAVANLAYFSINLCVFLIPRFLPRAFERYFQERGEIYAKSAE 251