BLASTX nr result
ID: Coptis25_contig00017770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017770 (1282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511739.1| conserved hypothetical protein [Ricinus comm... 72 4e-10 ref|XP_003623737.1| Ankyrin repeat and zinc finger domain-contai... 71 5e-10 ref|NP_001236287.1| uncharacterized protein LOC100527709 [Glycin... 70 1e-09 ref|XP_003551634.1| PREDICTED: ankyrin repeat and zinc finger do... 70 2e-09 ref|XP_004134343.1| PREDICTED: ankyrin repeat and zinc finger do... 64 8e-08 >ref|XP_002511739.1| conserved hypothetical protein [Ricinus communis] gi|223548919|gb|EEF50408.1| conserved hypothetical protein [Ricinus communis] Length = 666 Score = 71.6 bits (174), Expect = 4e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 CCNVSLSGKVPFHRYHYNYCSMSCMHVHREMLEDG 105 CCN SL+GK+PFHRY+Y YCS +CMHVHRE+LEDG Sbjct: 632 CCNASLAGKIPFHRYNYKYCSTTCMHVHREVLEDG 666 >ref|XP_003623737.1| Ankyrin repeat and zinc finger domain-containing protein [Medicago truncatula] gi|355498752|gb|AES79955.1| Ankyrin repeat and zinc finger domain-containing protein [Medicago truncatula] Length = 690 Score = 71.2 bits (173), Expect = 5e-10 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 CCNVSLSGKVPFHRYHYNYCSMSCMHVHREMLEDG 105 CCN SL+GKVPFHRY+Y YCS SCMHVH+E+LEDG Sbjct: 656 CCNSSLAGKVPFHRYNYKYCSTSCMHVHKEILEDG 690 >ref|NP_001236287.1| uncharacterized protein LOC100527709 [Glycine max] gi|255633002|gb|ACU16855.1| unknown [Glycine max] Length = 160 Score = 70.1 bits (170), Expect = 1e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 1 CCNVSLSGKVPFHRYHYNYCSMSCMHVHREMLED 102 CCN SL+GKVPFHRY+Y YCS SCMHVHRE+LED Sbjct: 126 CCNSSLAGKVPFHRYNYKYCSTSCMHVHREILED 159 >ref|XP_003551634.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Glycine max] Length = 649 Score = 69.7 bits (169), Expect = 2e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 CCNVSLSGKVPFHRYHYNYCSMSCMHVHREMLED 102 CCN SL GKVPFHRY+Y YCS SCMHVHRE+LED Sbjct: 615 CCNSSLDGKVPFHRYNYKYCSTSCMHVHREILED 648 >ref|XP_004134343.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Cucumis sativus] Length = 666 Score = 63.9 bits (154), Expect = 8e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +1 Query: 1 CCNVSLSGKVPFHRYHYNYCSMSCMHVHREMLED 102 CC+ SL+GKVPFHRY+Y YCS +CMHVH+E+L++ Sbjct: 632 CCSTSLAGKVPFHRYNYKYCSSTCMHVHKEVLDE 665