BLASTX nr result
ID: Coptis25_contig00017614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017614 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527094.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002527094.1| conserved hypothetical protein [Ricinus communis] gi|223533517|gb|EEF35257.1| conserved hypothetical protein [Ricinus communis] Length = 269 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 2/83 (2%) Frame = +1 Query: 7 FAKRKSFN--SPTITQEQKGTRESQPTMAQGPSKWSDYLAEDEDYLLFGTTGSLDDAQAP 180 FAK S + S T + K R QPT+A SKW+ Y+ D++ + + + D P Sbjct: 186 FAKVTSTSKWSDCTTGKYKEQRTVQPTLATKASKWNAYITHDDNDMGVRSGINFPDDMGP 245 Query: 181 FNHNMFETNFNDQRVEDEVHPDF 249 +H+++E+ +DQ+V+D++HPDF Sbjct: 246 CSHHVWESISDDQKVKDDIHPDF 268