BLASTX nr result
ID: Coptis25_contig00017560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017560 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADP20178.1| gag-pol polyprotein [Silene latifolia] 45 8e-06 >gb|ADP20178.1| gag-pol polyprotein [Silene latifolia] Length = 1518 Score = 45.4 bits (106), Expect(2) = 8e-06 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = -3 Query: 357 SKVRDKHLQHLELILDVLHTEKLYF*LNKCYLLVDSVSFLG 235 SK + +HL+HLE++ +L +KLY L KC +V+ V+FLG Sbjct: 776 SKTKGEHLKHLEVVFKILREQKLYGKLEKCTFMVEEVAFLG 816 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 448 FALSNASFTFTRLMTEILQ 392 F LSNA TF RLMTE+L+ Sbjct: 740 FGLSNAPSTFMRLMTEVLR 758