BLASTX nr result
ID: Coptis25_contig00017447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017447 (739 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528353.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002528353.1| conserved hypothetical protein [Ricinus communis] gi|223532221|gb|EEF34025.1| conserved hypothetical protein [Ricinus communis] Length = 211 Score = 57.8 bits (138), Expect = 2e-06 Identities = 43/148 (29%), Positives = 66/148 (44%), Gaps = 2/148 (1%) Frame = -3 Query: 728 KEYISGSPPSIARIPKSYVPSFTLPXXXXXXXXXXXXXEDI--RKKY*S*FNSAS*AVLS 555 KEY SP IA+IPK+YVP+ LP D R + AV+S Sbjct: 62 KEYRDVSPVPIAKIPKTYVPNILLPTESASEGVDNKSSSDEEDRPNIRASLVPRPRAVIS 121 Query: 554 SSDNDGIIGNRNQASGERNSIMKKSNLGAHTASQGKVNTRSVTAKVPVHMRRLCRETSSK 375 S DND +I N+N+ + S +K NL +Q KV + P++ + ++T+ K Sbjct: 122 SPDNDALIANKNRVKATQPSALKNHNLIRSRHAQCKVVPSQAIDESPLNTSK-SKDTTDK 180 Query: 374 KSDLKGKENPELTVPKQSPYLRKGKQRS 291 K D++G + + Q + K S Sbjct: 181 KIDVRGTKGSATVLSSQRRNITSAKPSS 208