BLASTX nr result
ID: Coptis25_contig00017280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00017280 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263592.1| PREDICTED: vacuolar protein sorting-associat... 70 2e-10 ref|XP_002302194.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_003526675.1| PREDICTED: vacuolar protein sorting-associat... 65 4e-09 ref|XP_003523398.1| PREDICTED: vacuolar protein sorting-associat... 65 4e-09 ref|XP_002306679.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 >ref|XP_002263592.1| PREDICTED: vacuolar protein sorting-associated protein 45 homolog [Vitis vinifera] gi|302142769|emb|CBI19972.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 283 AENIWHLRRQIASPRFGEYHLLFFSNIMKDTQIHILADSN 402 +ENI HLRRQ ASPRFGEYH LFFSNI+KDTQIHILADS+ Sbjct: 77 SENIQHLRRQFASPRFGEYH-LFFSNILKDTQIHILADSD 115 >ref|XP_002302194.1| predicted protein [Populus trichocarpa] gi|222843920|gb|EEE81467.1| predicted protein [Populus trichocarpa] Length = 568 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 283 AENIWHLRRQIASPRFGEYHLLFFSNIMKDTQIHILADSN 402 +ENI HLRRQ+A+PRFGE H LFFSNI+KDTQIHILADS+ Sbjct: 77 SENIQHLRRQLANPRFGESH-LFFSNILKDTQIHILADSD 115 >ref|XP_003526675.1| PREDICTED: vacuolar protein sorting-associated protein 45 homolog [Glycine max] Length = 568 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 283 AENIWHLRRQIASPRFGEYHLLFFSNIMKDTQIHILADSN 402 +ENI LRRQ+ASPRFGEYH LFFSNI+KDTQIH+LADS+ Sbjct: 77 SENIQLLRRQLASPRFGEYH-LFFSNILKDTQIHLLADSD 115 >ref|XP_003523398.1| PREDICTED: vacuolar protein sorting-associated protein 45 homolog [Glycine max] Length = 568 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 283 AENIWHLRRQIASPRFGEYHLLFFSNIMKDTQIHILADSN 402 +ENI LRRQ+ASPRFGEYH LFFSNI+KDTQIH+LADS+ Sbjct: 77 SENIQLLRRQLASPRFGEYH-LFFSNILKDTQIHLLADSD 115 >ref|XP_002306679.1| predicted protein [Populus trichocarpa] gi|222856128|gb|EEE93675.1| predicted protein [Populus trichocarpa] Length = 568 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 286 ENIWHLRRQIASPRFGEYHLLFFSNIMKDTQIHILADSN 402 ENI HLRRQ+A+PRFGE H LFFSN++KDTQIHILADS+ Sbjct: 78 ENIQHLRRQLANPRFGESH-LFFSNMLKDTQIHILADSD 115