BLASTX nr result
ID: Coptis25_contig00016999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016999 (595 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513134.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >ref|XP_002513134.1| conserved hypothetical protein [Ricinus communis] gi|223548145|gb|EEF49637.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +1 Query: 223 GKKRSRSLFWKVCAEMRRRQVARNKRSSFSRFHYNPFSYSLNFDNDNSGFFC 378 GK++ RSLFW+V AE+RR Q+ R + FS F Y+P SY+LNFDN N GF C Sbjct: 17 GKRKFRSLFWRVRAEIRR-QMKRRSKQRFS-FQYDPLSYALNFDNGNFGFLC 66