BLASTX nr result
ID: Coptis25_contig00016837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016837 (721 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532131.1| conserved hypothetical protein [Ricinus comm... 46 3e-07 >ref|XP_002532131.1| conserved hypothetical protein [Ricinus communis] gi|223528190|gb|EEF30251.1| conserved hypothetical protein [Ricinus communis] Length = 1033 Score = 46.2 bits (108), Expect(2) = 3e-07 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = -3 Query: 638 NMLDSGDISXXXXXXXXXXXLEQVANXXXXXXXXXXXDAETDAPSDLAE-----GDGDES 474 N+LDS ++S L+QVAN D E D PSD+ E DGD+S Sbjct: 900 NLLDSANLSLEADGEYDYDDLDQVANEDDDDLIGDVSDVEMDLPSDMGEAFDGIADGDKS 959 Query: 473 DGLDHVDVGDADGFSEE 423 D ++ +D+GDAD S + Sbjct: 960 DDVEAIDIGDADDGSND 976 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -2 Query: 318 ASPFASLEEYNHLLNED 268 ASPFA+LE+Y HLLNED Sbjct: 995 ASPFANLEDYEHLLNED 1011