BLASTX nr result
ID: Coptis25_contig00016830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016830 (697 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520966.1| RNA binding protein, putative [Ricinus commu... 44 3e-06 >ref|XP_002520966.1| RNA binding protein, putative [Ricinus communis] gi|223539803|gb|EEF41383.1| RNA binding protein, putative [Ricinus communis] Length = 383 Score = 44.3 bits (103), Expect(2) = 3e-06 Identities = 22/43 (51%), Positives = 25/43 (58%) Frame = +3 Query: 267 GSIHLKGFQRSNLRVRQAWQNNKWVVIEKV*INLPFHQEVTNN 395 GSI LK F S LR+ Q W NKW V+EKV N +E T N Sbjct: 106 GSIQLKEFHESKLRIHQTWNKNKWSVMEKVAQNKEPTKESTEN 148 Score = 32.7 bits (73), Expect(2) = 3e-06 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 11/66 (16%) Frame = +2 Query: 53 SWFPGIIISEDIDIHTLLDIYLSIMKMLGLIRHQ*RE*ER-----------MVGDSAEAF 199 SWFPG +IS D D + + L+ + +I +E R MVGD AE F Sbjct: 21 SWFPGYLISVDGDCYIVRYYLLADPEGEPVIEKVHKEDVRPQPPSKRKKRWMVGDVAEVF 80 Query: 200 NLQCWR 217 ++Q WR Sbjct: 81 DIQRWR 86