BLASTX nr result
ID: Coptis25_contig00016424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016424 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283262.2| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_004134398.1| PREDICTED: pentatricopeptide repeat-containi... 85 5e-15 ref|XP_003524140.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-13 ref|XP_003532686.1| PREDICTED: pentatricopeptide repeat-containi... 78 6e-13 ref|XP_002528356.1| pentatricopeptide repeat-containing protein,... 75 5e-12 >ref|XP_002283262.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 590 Score = 90.1 bits (222), Expect = 2e-16 Identities = 49/75 (65%), Positives = 60/75 (80%), Gaps = 2/75 (2%) Frame = -3 Query: 221 DLSLINNLLTSYSKSNLLSDALRLFRQ-ILSPNVVTWTALISS-TNTVFSFHHYISMLRY 48 D S N+L+T YSKSNLLS A+R+F I SPNVV+WTALIS+ +T F+ H+ISMLR+ Sbjct: 46 DRSFYNSLITLYSKSNLLSKAVRIFHHHIPSPNVVSWTALISAYASTSFALLHFISMLRH 105 Query: 47 PKLPNERTLASLLKT 3 P LPN+RTLASLLKT Sbjct: 106 PTLPNQRTLASLLKT 120 >ref|XP_004134398.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] gi|449487598|ref|XP_004157706.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 583 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/69 (60%), Positives = 53/69 (76%), Gaps = 1/69 (1%) Frame = -3 Query: 206 NNLLTSYSKSNLLSDALRLFRQILSPNVVTWTALISS-TNTVFSFHHYISMLRYPKLPNE 30 NNL+T YSK+NLL + RLF QI P++V+WTALIS+ ++T S H++SMLRYP PNE Sbjct: 48 NNLITRYSKANLLHYSARLFNQIPFPDIVSWTALISAHSSTFLSLRHFVSMLRYPTFPNE 107 Query: 29 RTLASLLKT 3 RTLA L KT Sbjct: 108 RTLAPLFKT 116 >ref|XP_003524140.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 561 Score = 80.5 bits (197), Expect = 1e-13 Identities = 43/76 (56%), Positives = 57/76 (75%), Gaps = 2/76 (2%) Frame = -3 Query: 224 KDLSLINNLLTSYSKSNLLSDALRLFRQI-LSPNVVTWTALISS-TNTVFSFHHYISMLR 51 KD ++ NNL+T YSKSNL S A+ LF ++ PNVV+WTALIS+ +NT+ S H+++MLR Sbjct: 32 KDRAVWNNLITHYSKSNLSSYAVSLFHRLPFPPNVVSWTALISAHSNTLLSLRHFLAMLR 91 Query: 50 YPKLPNERTLASLLKT 3 + LPN RTLASL T Sbjct: 92 HNTLPNHRTLASLFAT 107 >ref|XP_003532686.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 561 Score = 78.2 bits (191), Expect = 6e-13 Identities = 41/77 (53%), Positives = 59/77 (76%), Gaps = 2/77 (2%) Frame = -3 Query: 227 MKDLSLINNLLTSYSKSNLLSDALRLFRQI-LSPNVVTWTALISS-TNTVFSFHHYISML 54 +KD ++ NNL+T YSKS+L S A+ LF+++ PNVV+WTALIS+ +NT+ S H+++ML Sbjct: 31 IKDRAVWNNLITHYSKSDLSSYAVSLFQRLPFPPNVVSWTALISAHSNTLLSLRHFLAML 90 Query: 53 RYPKLPNERTLASLLKT 3 R+ LPN RT+ASL T Sbjct: 91 RHNTLPNHRTVASLFTT 107 >ref|XP_002528356.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532224|gb|EEF34028.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 356 Score = 75.1 bits (183), Expect = 5e-12 Identities = 41/76 (53%), Positives = 56/76 (73%), Gaps = 4/76 (5%) Frame = -3 Query: 221 DLSLINNLLTSYSKSN---LLSDALRLFRQILSPNVVTWTALISS-TNTVFSFHHYISML 54 +LS N+L+T YS+S + S A RLF + SPN+V+WT+LIS+ T++ S HH++SML Sbjct: 25 NLSCFNHLITLYSRSPNFLVFSYANRLFSLLPSPNIVSWTSLISAHTHSFLSLHHFLSML 84 Query: 53 RYPKLPNERTLASLLK 6 R P LPN+RTLASL K Sbjct: 85 RRPILPNQRTLASLFK 100