BLASTX nr result
ID: Coptis25_contig00016385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016385 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634690.1| PREDICTED: cytochrome b6-f complex iron-sulf... 90 2e-16 ref|XP_002284361.1| PREDICTED: cytochrome b6-f complex iron-sulf... 90 2e-16 sp|P30361.2|UCRIA_TOBAC RecName: Full=Cytochrome b6-f complex ir... 89 5e-16 emb|CAA45705.1| Rieske Fe/S protein of cytochrome b6/f complex [... 89 5e-16 ref|XP_002265183.2| PREDICTED: cytochrome b6-f complex iron-sulf... 88 6e-16 >ref|XP_003634690.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic isoform 2 [Vitis vinifera] Length = 244 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 246 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGQDPWWA 127 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTG+DPWWA Sbjct: 205 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGEDPWWA 244 >ref|XP_002284361.1| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic isoform 1 [Vitis vinifera] gi|147826727|emb|CAN66108.1| hypothetical protein VITISV_020089 [Vitis vinifera] gi|302143099|emb|CBI20394.3| unnamed protein product [Vitis vinifera] Length = 228 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 246 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGQDPWWA 127 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTG+DPWWA Sbjct: 189 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGEDPWWA 228 >sp|P30361.2|UCRIA_TOBAC RecName: Full=Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic; AltName: Full=Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1; AltName: Full=Rieske iron-sulfur protein 1; Short=ISP 1; Short=RISP 1; Flags: Precursor gi|19995|emb|CAA46808.1| Rieske FeS [Nicotiana tabacum] Length = 228 Score = 88.6 bits (218), Expect = 5e-16 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 246 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGQDPWWA 127 VRGPAPLSLALAHADIDDGKV+FVPWVETDFRTG+DPWWA Sbjct: 189 VRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGEDPWWA 228 >emb|CAA45705.1| Rieske Fe/S protein of cytochrome b6/f complex [Nicotiana tabacum] Length = 228 Score = 88.6 bits (218), Expect = 5e-16 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 246 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGQDPWWA 127 VRGPAPLSLALAHADIDDGKV+FVPWVETDFRTG+DPWWA Sbjct: 189 VRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGEDPWWA 228 >ref|XP_002265183.2| PREDICTED: cytochrome b6-f complex iron-sulfur subunit, chloroplastic-like [Vitis vinifera] Length = 212 Score = 88.2 bits (217), Expect = 6e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 246 VRGPAPLSLALAHADIDDGKVLFVPWVETDFRTGQDPWWA 127 VRGPAPLSLALAHADIDDGKV+F+PWVETDFRTG+DPWWA Sbjct: 173 VRGPAPLSLALAHADIDDGKVVFIPWVETDFRTGEDPWWA 212