BLASTX nr result
ID: Coptis25_contig00016274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016274 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633563.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 65 4e-09 emb|CBI24913.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002277955.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 65 4e-09 ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ri... 64 1e-08 ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >ref|XP_003633563.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 2 [Vitis vinifera] Length = 377 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -3 Query: 416 DFVYTVASQSPTKHFVIHAQKALLNGISPA-NRKVHPLKKNY 294 DF+Y V+SQSPT+HF+IH++KALLNGISPA NRK+ PLK Y Sbjct: 156 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLKYEY 197 >emb|CBI24913.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -3 Query: 416 DFVYTVASQSPTKHFVIHAQKALLNGISPA-NRKVHPLKKNY 294 DF+Y V+SQSPT+HF+IH++KALLNGISPA NRK+ PLK Y Sbjct: 202 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLKYEY 243 >ref|XP_002277955.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 1 [Vitis vinifera] Length = 433 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -3 Query: 416 DFVYTVASQSPTKHFVIHAQKALLNGISPA-NRKVHPLKKNY 294 DF+Y V+SQSPT+HF+IH++KALLNGISPA NRK+ PLK Y Sbjct: 212 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLKYEY 253 >ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] gi|223543088|gb|EEF44623.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] Length = 375 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/42 (71%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 416 DFVYTVASQSPTKHFVIHAQKALLNGISPA-NRKVHPLKKNY 294 DF+Y V+S SPTKHF+IH++KALLNGISPA NRK+ PLK Y Sbjct: 156 DFIYKVSSLSPTKHFIIHSRKALLNGISPAENRKIPPLKYEY 197 >ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|222850448|gb|EEE87995.1| predicted protein [Populus trichocarpa] Length = 380 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -3 Query: 416 DFVYTVASQSPTKHFVIHAQKALLNGISPA-NRKVHPLKKNY 294 DF+Y V+S SPTKHF+IH++KALLNGISPA NR++ PLK Y Sbjct: 156 DFIYKVSSLSPTKHFIIHSRKALLNGISPADNRRIPPLKYEY 197