BLASTX nr result
ID: Coptis25_contig00016248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016248 (522 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283471.1| PREDICTED: auxin-induced protein PCNT115 [Vi... 56 3e-06 ref|XP_002517067.1| aldo/keto reductase, putative [Ricinus commu... 56 4e-06 ref|NP_001242478.1| uncharacterized protein LOC100811411 [Glycin... 55 5e-06 >ref|XP_002283471.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|297737113|emb|CBI26314.3| unnamed protein product [Vitis vinifera] Length = 345 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 431 RQLGIGIVAYSPLGRGFFGGKAVVERLP 514 R+LGIGIVAYSPLGRGFFGGKAVVE LP Sbjct: 203 RELGIGIVAYSPLGRGFFGGKAVVESLP 230 >ref|XP_002517067.1| aldo/keto reductase, putative [Ricinus communis] gi|223543702|gb|EEF45230.1| aldo/keto reductase, putative [Ricinus communis] Length = 350 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 431 RQLGIGIVAYSPLGRGFFGGKAVVERLPEK 520 R+LGIGIVAYSPLGRGF GKAVVE LPEK Sbjct: 203 RELGIGIVAYSPLGRGFLAGKAVVENLPEK 232 >ref|NP_001242478.1| uncharacterized protein LOC100811411 [Glycine max] gi|255637199|gb|ACU18930.1| unknown [Glycine max] Length = 348 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 431 RQLGIGIVAYSPLGRGFFGGKAVVERLPEK 520 RQLGIGIVAYSPLGRGFF GKAVVE LP + Sbjct: 204 RQLGIGIVAYSPLGRGFFAGKAVVETLPSQ 233