BLASTX nr result
ID: Coptis25_contig00016161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016161 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526814.1| peptidase, putative [Ricinus communis] gi|22... 82 6e-14 ref|XP_002277352.1| PREDICTED: subtilisin-like protease isoform ... 79 3e-13 emb|CAN68260.1| hypothetical protein VITISV_004265 [Vitis vinife... 79 3e-13 gb|AFK40738.1| unknown [Medicago truncatula] 78 7e-13 ref|XP_003590254.1| Xylem serine proteinase [Medicago truncatula... 78 7e-13 >ref|XP_002526814.1| peptidase, putative [Ricinus communis] gi|223533818|gb|EEF35549.1| peptidase, putative [Ricinus communis] Length = 129 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = +3 Query: 3 YKAAASGFSAKLTPEQVSQISKEPGVLQVVPSRTYQLHSGPGNLH 137 YK AASGFSAKLTPEQV+QISK+PGVLQVVPSRT QLHSGP LH Sbjct: 85 YKTAASGFSAKLTPEQVAQISKQPGVLQVVPSRTVQLHSGPAKLH 129 >ref|XP_002277352.1| PREDICTED: subtilisin-like protease isoform 1 [Vitis vinifera] gi|225460546|ref|XP_002277374.1| PREDICTED: subtilisin-like protease isoform 2 [Vitis vinifera] Length = 130 Score = 79.3 bits (194), Expect = 3e-13 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = +3 Query: 3 YKAAASGFSAKLTPEQVSQISKEPGVLQVVPSRTYQLHSGPGNLH 137 YK AASGFSAKLTPEQVSQIS PGVLQVVPSRT QLHSGPG LH Sbjct: 77 YKNAASGFSAKLTPEQVSQISTLPGVLQVVPSRTLQLHSGPGMLH 121 >emb|CAN68260.1| hypothetical protein VITISV_004265 [Vitis vinifera] gi|296081023|emb|CBI18527.3| unnamed protein product [Vitis vinifera] Length = 108 Score = 79.3 bits (194), Expect = 3e-13 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = +3 Query: 3 YKAAASGFSAKLTPEQVSQISKEPGVLQVVPSRTYQLHSGPGNLH 137 YK AASGFSAKLTPEQVSQIS PGVLQVVPSRT QLHSGPG LH Sbjct: 55 YKNAASGFSAKLTPEQVSQISTLPGVLQVVPSRTLQLHSGPGMLH 99 >gb|AFK40738.1| unknown [Medicago truncatula] Length = 130 Score = 78.2 bits (191), Expect = 7e-13 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +3 Query: 3 YKAAASGFSAKLTPEQVSQISKEPGVLQVVPSRTYQLHSGPGNLH 137 YK+AASGFSAKLTP QV QISK+PGVLQVVPS+T QLHSGP LH Sbjct: 86 YKSAASGFSAKLTPHQVEQISKQPGVLQVVPSQTVQLHSGPNKLH 130 >ref|XP_003590254.1| Xylem serine proteinase [Medicago truncatula] gi|355479302|gb|AES60505.1| Xylem serine proteinase [Medicago truncatula] gi|388517597|gb|AFK46860.1| unknown [Medicago truncatula] Length = 130 Score = 78.2 bits (191), Expect = 7e-13 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +3 Query: 3 YKAAASGFSAKLTPEQVSQISKEPGVLQVVPSRTYQLHSGPGNLH 137 YK+AASGFSAKLTP QV QISK+PGVLQVVPS+T QLHSGP LH Sbjct: 86 YKSAASGFSAKLTPHQVEQISKQPGVLQVVPSQTVQLHSGPNKLH 130