BLASTX nr result
ID: Coptis25_contig00016094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00016094 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512617.1| cytochrome oxidase biogenesis protein, putat... 121 7e-26 ref|XP_002313020.1| inner membrane protein [Populus trichocarpa]... 119 3e-25 ref|XP_002273357.1| PREDICTED: ALBINO3-like protein 2, chloropla... 115 5e-24 ref|XP_004138896.1| PREDICTED: ALBINO3-like protein 3, mitochond... 112 4e-23 ref|XP_003624125.1| ALBINO3-like protein [Medicago truncatula] g... 102 4e-20 >ref|XP_002512617.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis] gi|223548578|gb|EEF50069.1| cytochrome oxidase biogenesis protein, putative [Ricinus communis] Length = 548 Score = 121 bits (303), Expect = 7e-26 Identities = 53/72 (73%), Positives = 61/72 (84%) Frame = -3 Query: 221 KSYIKQYLLFRKEKQAIGCPSALWGLASVTVQIPCFLLLMASIRKMSLDHHPGFDCGGTL 42 KS++ Q LF KE++A+GCPS LW LA V+ Q+PCFLL M SIR+MSLDHHPGFDCGGTL Sbjct: 168 KSFVDQISLFHKERRALGCPSYLWFLAYVSAQVPCFLLWMTSIRRMSLDHHPGFDCGGTL 227 Query: 41 WFQNLTETPHGI 6 WFQNLTE PHGI Sbjct: 228 WFQNLTEYPHGI 239 >ref|XP_002313020.1| inner membrane protein [Populus trichocarpa] gi|222849428|gb|EEE86975.1| inner membrane protein [Populus trichocarpa] Length = 499 Score = 119 bits (298), Expect = 3e-25 Identities = 53/73 (72%), Positives = 62/73 (84%) Frame = -3 Query: 221 KSYIKQYLLFRKEKQAIGCPSALWGLASVTVQIPCFLLLMASIRKMSLDHHPGFDCGGTL 42 +SYI+Q LFR E++AIGCPS LW LA ++VQIPCFLL M SIR+M LD+HPGFDCGG L Sbjct: 159 RSYIEQISLFRNERRAIGCPSYLWFLAFLSVQIPCFLLWMTSIRRMCLDNHPGFDCGGAL 218 Query: 41 WFQNLTETPHGIL 3 WFQNLTE PHG+L Sbjct: 219 WFQNLTELPHGVL 231 >ref|XP_002273357.1| PREDICTED: ALBINO3-like protein 2, chloroplastic [Vitis vinifera] gi|297735304|emb|CBI17666.3| unnamed protein product [Vitis vinifera] Length = 572 Score = 115 bits (287), Expect = 5e-24 Identities = 52/73 (71%), Positives = 60/73 (82%) Frame = -3 Query: 221 KSYIKQYLLFRKEKQAIGCPSALWGLASVTVQIPCFLLLMASIRKMSLDHHPGFDCGGTL 42 +SY Q LFRKEK+AIGCPS LW LAS++ Q+PCF+L M SIR MSLDHHPGFD GG L Sbjct: 169 RSYFDQISLFRKEKRAIGCPSFLWFLASLSTQVPCFILWMMSIRWMSLDHHPGFDSGGAL 228 Query: 41 WFQNLTETPHGIL 3 WFQNLTE P+G+L Sbjct: 229 WFQNLTEFPNGVL 241 >ref|XP_004138896.1| PREDICTED: ALBINO3-like protein 3, mitochondrial-like [Cucumis sativus] Length = 573 Score = 112 bits (279), Expect = 4e-23 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = -3 Query: 221 KSYIKQYLLFRKEKQAIGCPSALWGLASVTVQIPCFLLLMASIRKMSLDHHPGFDCGGTL 42 +SYI Q LFRKE++AIGCPS LW A +Q+PCFLL M +IRKMSLDH+PGFD GG L Sbjct: 191 RSYIDQISLFRKERKAIGCPSFLWFAAYFFIQVPCFLLWMVTIRKMSLDHYPGFDYGGAL 250 Query: 41 WFQNLTETPHGI 6 WFQNLTE PHG+ Sbjct: 251 WFQNLTEYPHGV 262 >ref|XP_003624125.1| ALBINO3-like protein [Medicago truncatula] gi|355499140|gb|AES80343.1| ALBINO3-like protein [Medicago truncatula] Length = 595 Score = 102 bits (253), Expect = 4e-20 Identities = 44/71 (61%), Positives = 53/71 (74%) Frame = -3 Query: 221 KSYIKQYLLFRKEKQAIGCPSALWGLASVTVQIPCFLLLMASIRKMSLDHHPGFDCGGTL 42 KSYI+Q F ++++A+GCPS W L VQ+PCF + M SIR+MSLD HPGFDCGG L Sbjct: 156 KSYIRQMRFFEEKRKAVGCPSYAWPLLPFIVQVPCFFVWMFSIRRMSLDGHPGFDCGGAL 215 Query: 41 WFQNLTETPHG 9 WFQNLTE HG Sbjct: 216 WFQNLTEFSHG 226