BLASTX nr result
ID: Coptis25_contig00015967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015967 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242036.1| uncharacterized protein LOC100793642 [Glycin... 59 5e-07 gb|ACJ83453.1| unknown [Medicago truncatula] 59 5e-07 gb|AAQ62584.1| putative Rab geranylgeranyl transferase type II b... 59 5e-07 ref|XP_002319501.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_003524939.1| PREDICTED: geranylgeranyl transferase type-2... 56 3e-06 >ref|NP_001242036.1| uncharacterized protein LOC100793642 [Glycine max] gi|255635594|gb|ACU18147.1| unknown [Glycine max] Length = 317 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 GLSLLEYPGLKTIDPAYALPVDVVNNIFFGK 94 GLSLLEYPGLK +DPAYALPVDVVN IFF K Sbjct: 283 GLSLLEYPGLKPVDPAYALPVDVVNRIFFTK 313 >gb|ACJ83453.1| unknown [Medicago truncatula] Length = 63 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 GLSLLEYPGLKTIDPAYALPVDVVNNIFFGK 94 GLSLLEYPG+K IDPAYALPVDVVN IFF K Sbjct: 33 GLSLLEYPGVKPIDPAYALPVDVVNRIFFSK 63 >gb|AAQ62584.1| putative Rab geranylgeranyl transferase type II beta subunit [Glycine max] Length = 317 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 GLSLLEYPGLKTIDPAYALPVDVVNNIFFGK 94 GLSLLEYPGLK +DPAYALPVDVVN IFF K Sbjct: 283 GLSLLEYPGLKPVDPAYALPVDVVNRIFFTK 313 >ref|XP_002319501.1| predicted protein [Populus trichocarpa] gi|222857877|gb|EEE95424.1| predicted protein [Populus trichocarpa] Length = 313 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 GLSLLEYPGLKTIDPAYALPVDVVNNIFFGK 94 GLSLLEYPGLK IDPA+ALPVDVVN IFF K Sbjct: 283 GLSLLEYPGLKAIDPAHALPVDVVNRIFFQK 313 >ref|XP_003524939.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Glycine max] Length = 320 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 2 GLSLLEYPGLKTIDPAYALPVDVVNNIFFGK 94 GLSLLEYPGLK +DPAYALPVDVVN I F K Sbjct: 290 GLSLLEYPGLKPVDPAYALPVDVVNRIIFTK 320