BLASTX nr result
ID: Coptis25_contig00015524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015524 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137888.1| PREDICTED: pentatricopeptide repeat-containi... 142 3e-32 ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containi... 140 1e-31 emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] 130 1e-28 ref|XP_003522599.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|XP_003607207.1| Pentatricopeptide repeat-containing protein ... 123 2e-26 >ref|XP_004137888.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] gi|449521725|ref|XP_004167880.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Cucumis sativus] Length = 521 Score = 142 bits (358), Expect = 3e-32 Identities = 66/98 (67%), Positives = 79/98 (80%) Frame = -3 Query: 299 YGCMVDLFSRWGKLDEAYQVIKTMPFDANSVLWRTLLGSCRTYGNVELAEEAFSMISELE 120 YGCM+DL SRWG L+EAY +IKT PF + SVLWRTLLG CR + +VEL EE+F ++ELE Sbjct: 418 YGCMIDLLSRWGFLEEAYVMIKTCPFSSCSVLWRTLLGGCRLHRHVELGEESFRKLAELE 477 Query: 119 PPKDGDYVLLSNIYADMEKWEDVERMRNVMIELGVLKK 6 P KDGDYVLLSNIYA+ E+W+DVER+R MI GV KK Sbjct: 478 PGKDGDYVLLSNIYAEEERWDDVERLRKEMINYGVCKK 515 >ref|XP_002267783.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 636 Score = 140 bits (353), Expect = 1e-31 Identities = 65/99 (65%), Positives = 82/99 (82%) Frame = -3 Query: 299 YGCMVDLFSRWGKLDEAYQVIKTMPFDANSVLWRTLLGSCRTYGNVELAEEAFSMISELE 120 YGCMVDL SR G L EA+ +IKTMPF+ANSVLWRTLLG+CR + +V+LAEE+F + ++E Sbjct: 530 YGCMVDLLSRCGLLKEAHHMIKTMPFEANSVLWRTLLGACRVHHHVDLAEESFQQLGKME 589 Query: 119 PPKDGDYVLLSNIYADMEKWEDVERMRNVMIELGVLKKP 3 P +DGDYVLLSNIYA+ ++W DVER+R+ MI GV KKP Sbjct: 590 PLRDGDYVLLSNIYAEAQRWNDVERVRSEMIGSGVPKKP 628 >emb|CAN68178.1| hypothetical protein VITISV_000846 [Vitis vinifera] Length = 633 Score = 130 bits (327), Expect = 1e-28 Identities = 59/96 (61%), Positives = 77/96 (80%) Frame = -3 Query: 299 YGCMVDLFSRWGKLDEAYQVIKTMPFDANSVLWRTLLGSCRTYGNVELAEEAFSMISELE 120 YGCMVDL SR G L EA+ +IKTMPF+ANSVLWRTLLG+CR + +V+LAEE+F + ++E Sbjct: 424 YGCMVDLLSRCGLLKEAHHMIKTMPFEANSVLWRTLLGACRVHHHVDLAEESFQQLGKME 483 Query: 119 PPKDGDYVLLSNIYADMEKWEDVERMRNVMIELGVL 12 P +DGDYVLLSNIYA+ ++W DVER ++ L V+ Sbjct: 484 PLRDGDYVLLSNIYAEAQRWNDVERASKILANLIVM 519 >ref|XP_003522599.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Glycine max] Length = 535 Score = 124 bits (310), Expect = 1e-26 Identities = 58/98 (59%), Positives = 79/98 (80%) Frame = -3 Query: 299 YGCMVDLFSRWGKLDEAYQVIKTMPFDANSVLWRTLLGSCRTYGNVELAEEAFSMISELE 120 YGC+VDL SR+G L+EA+Q+IKT P +++LWRTLLG+CRT GNVELA+ +F +++L Sbjct: 423 YGCIVDLLSRFGLLEEAHQMIKTAPLQNSAILWRTLLGACRTQGNVELAKVSFQQLAKLG 482 Query: 119 PPKDGDYVLLSNIYADMEKWEDVERMRNVMIELGVLKK 6 DGDYVLLSNIYA+ E+W++VER+R+ MI L V K+ Sbjct: 483 RLTDGDYVLLSNIYAEAERWDEVERVRSEMIGLHVPKQ 520 >ref|XP_003607207.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355508262|gb|AES89404.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 542 Score = 123 bits (308), Expect = 2e-26 Identities = 58/95 (61%), Positives = 73/95 (76%) Frame = -3 Query: 299 YGCMVDLFSRWGKLDEAYQVIKTMPFDANSVLWRTLLGSCRTYGNVELAEEAFSMISELE 120 YGCMVDL SRWG L+EAYQ+I T PF + VLWRTLLG+CRT N ELAE +F +++L+ Sbjct: 430 YGCMVDLLSRWGLLEEAYQIIMTAPFQNSVVLWRTLLGACRTQSNTELAEISFKQLAKLK 489 Query: 119 PPKDGDYVLLSNIYADMEKWEDVERMRNVMIELGV 15 DGDYVLLSNIYA+ +W++VER+R+ M L V Sbjct: 490 QLIDGDYVLLSNIYAEAGRWDEVERLRSEMDYLHV 524