BLASTX nr result
ID: Coptis25_contig00015483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015483 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/57 (57%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -2 Query: 265 YVWAQKGTTTHLYSIPDGIKKLIEKD-APEVLHKPLTPSTYGNYFAALLCAEDYYIE 98 Y+W QKG + +Y+IP I+ LI++D P VL+KPL+ STY +YFAALL AED+YIE Sbjct: 233 YMWVQKGMSP-IYAIPKDIEDLIKRDKVPGVLNKPLSLSTYKDYFAALLYAEDFYIE 288 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -2 Query: 265 YVWAQKGTTTHLYSIPDGIKKLIEKD-APEVLHKPLTPSTYGNYFAALLCAEDYYIE 98 Y+ QK T +Y IP I+ LI+ D PEVL KPL+ STY +YFAALL AEDYYIE Sbjct: 264 YILVQKDITP-IYMIPKDIESLIKSDKVPEVLKKPLSLSTYKDYFAALLYAEDYYIE 319 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/46 (58%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 232 LYSIPDGIKKLIEKD-APEVLHKPLTPSTYGNYFAALLCAEDYYIE 98 +Y++P I+ LI++D PEVL++ L+PSTY +YFAALL AED+YIE Sbjct: 325 IYAVPKDIEDLIKRDIVPEVLNEMLSPSTYKDYFAALLYAEDFYIE 370