BLASTX nr result
ID: Coptis25_contig00015445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015445 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17567.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002273483.1| PREDICTED: uncharacterized protein LOC100254... 56 3e-06 >emb|CBI17567.3| unnamed protein product [Vitis vinifera] Length = 517 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +1 Query: 1 ALPFGLCNLFYSPLYLTYKRDHESARLASLKEQE 102 A+PFGLC LFY+PLY+ ++RD E+AR+ASLKE+E Sbjct: 482 AVPFGLCCLFYTPLYVVFRRDRENARIASLKEEE 515 >ref|XP_002273483.1| PREDICTED: uncharacterized protein LOC100254794 [Vitis vinifera] Length = 494 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +1 Query: 1 ALPFGLCNLFYSPLYLTYKRDHESARLASLKEQE 102 A+PFGLC LFY+PLY+ ++RD E+AR+ASLKE+E Sbjct: 459 AVPFGLCCLFYTPLYVVFRRDRENARIASLKEEE 492