BLASTX nr result
ID: Coptis25_contig00015286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015286 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002969864.1| hypothetical protein SELMODRAFT_92589 [Selag... 90 2e-16 ref|XP_002985196.1| hypothetical protein SELMODRAFT_121931 [Sela... 90 2e-16 ref|XP_003524582.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 88 6e-16 dbj|BAL14274.1| cyclophilin 40 [Nicotiana tabacum] 88 8e-16 ref|XP_003550075.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 87 1e-15 >ref|XP_002969864.1| hypothetical protein SELMODRAFT_92589 [Selaginella moellendorffii] gi|300162375|gb|EFJ28988.1| hypothetical protein SELMODRAFT_92589 [Selaginella moellendorffii] Length = 361 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 142 MVNNPRCYLDISIGGELEGRIVIELFSDIVPKTAENFRALCTGEKGI 2 M NPRCY+DISIGGELEGRIV+ELF+DIVP+TAENFRALCTGEKG+ Sbjct: 1 MAPNPRCYMDISIGGELEGRIVVELFADIVPRTAENFRALCTGEKGV 47 >ref|XP_002985196.1| hypothetical protein SELMODRAFT_121931 [Selaginella moellendorffii] gi|300147024|gb|EFJ13690.1| hypothetical protein SELMODRAFT_121931 [Selaginella moellendorffii] Length = 361 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -2 Query: 142 MVNNPRCYLDISIGGELEGRIVIELFSDIVPKTAENFRALCTGEKGI 2 M NPRCY+DISIGGELEGRIV+ELF+DIVP+TAENFRALCTGEKG+ Sbjct: 1 MAPNPRCYMDISIGGELEGRIVVELFADIVPRTAENFRALCTGEKGV 47 >ref|XP_003524582.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Glycine max] Length = 360 Score = 88.2 bits (217), Expect = 6e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 133 NPRCYLDISIGGELEGRIVIELFSDIVPKTAENFRALCTGEKGI 2 NPRC+LD+SIGGELEGRIV+ELF D+VPKTAENFRALCTGEKGI Sbjct: 3 NPRCFLDVSIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGI 46 >dbj|BAL14274.1| cyclophilin 40 [Nicotiana tabacum] Length = 362 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 139 VNNPRCYLDISIGGELEGRIVIELFSDIVPKTAENFRALCTGEKGI 2 + PRCYLDISIGGELEGRIV+EL++D+VPKTAENFRALCTGEKGI Sbjct: 1 MGRPRCYLDISIGGELEGRIVVELYNDVVPKTAENFRALCTGEKGI 46 >ref|XP_003550075.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Glycine max] Length = 360 Score = 87.4 bits (215), Expect = 1e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 133 NPRCYLDISIGGELEGRIVIELFSDIVPKTAENFRALCTGEKGI 2 NPRC+LDI+IGGELEGRIV+ELF D+VPKTAENFRALCTGEKGI Sbjct: 3 NPRCFLDITIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGI 46