BLASTX nr result
ID: Coptis25_contig00015227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015227 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326116.1| PAF1 complex component [Populus trichocarpa]... 68 9e-10 ref|XP_003533781.1| PREDICTED: RNA polymerase-associated protein... 67 1e-09 ref|XP_002516292.1| tpr repeat nuclear phosphoprotein, putative ... 67 1e-09 ref|XP_003546500.1| PREDICTED: RNA polymerase-associated protein... 67 1e-09 ref|XP_004144025.1| PREDICTED: RNA polymerase-associated protein... 67 2e-09 >ref|XP_002326116.1| PAF1 complex component [Populus trichocarpa] gi|222833309|gb|EEE71786.1| PAF1 complex component [Populus trichocarpa] Length = 1056 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 120 MIGALELKNDDWLKAKETLHAARETTDGKDFYSALSLGNW 1 M+G LELKNDDW+KAKET AA E TDGKD Y+ LSLGNW Sbjct: 595 MLGDLELKNDDWVKAKETFRAASEATDGKDSYATLSLGNW 634 >ref|XP_003533781.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Glycine max] Length = 1086 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -2 Query: 120 MIGALELKNDDWLKAKETLHAARETTDGKDFYSALSLGNW 1 M+G LELKNDDW+KAKETL AA + T+GKD Y++LSLGNW Sbjct: 594 MLGELELKNDDWVKAKETLRAASDATEGKDSYASLSLGNW 633 >ref|XP_002516292.1| tpr repeat nuclear phosphoprotein, putative [Ricinus communis] gi|223544778|gb|EEF46294.1| tpr repeat nuclear phosphoprotein, putative [Ricinus communis] Length = 1065 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -2 Query: 120 MIGALELKNDDWLKAKETLHAARETTDGKDFYSALSLGNW 1 M+G LELKNDDW+KAKET AA E TDGKD Y+ LSLGNW Sbjct: 571 MLGDLELKNDDWVKAKETFRAASEATDGKDSYAILSLGNW 610 >ref|XP_003546500.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Glycine max] Length = 1088 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 120 MIGALELKNDDWLKAKETLHAARETTDGKDFYSALSLGNW 1 M+G LELKNDDW+KAKETL A + TDGKD Y+ LSLGNW Sbjct: 597 MLGELELKNDDWVKAKETLRTASDATDGKDSYATLSLGNW 636 >ref|XP_004144025.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Cucumis sativus] Length = 1074 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 120 MIGALELKNDDWLKAKETLHAARETTDGKDFYSALSLGNW 1 M+G LELKNDDW++AKET AA E TDGKD Y+ LSLGNW Sbjct: 595 MLGELELKNDDWVRAKETFRAAGEATDGKDSYATLSLGNW 634