BLASTX nr result
ID: Coptis25_contig00015185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015185 (590 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512730.1| pentatricopeptide repeat-containing protein,... 71 2e-10 ref|XP_002332054.1| predicted protein [Populus trichocarpa] gi|2... 62 9e-08 ref|NP_178203.1| pentatricopeptide repeat-containing protein [Ar... 59 6e-07 ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002887806.1| predicted protein [Arabidopsis lyrata subsp.... 56 4e-06 >ref|XP_002512730.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547741|gb|EEF49233.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 552 Score = 70.9 bits (172), Expect = 2e-10 Identities = 44/113 (38%), Positives = 61/113 (53%), Gaps = 5/113 (4%) Frame = +3 Query: 264 FSATDHQSFIPPSSSRTQFFKHHLFPLKLSTFNLEL-ELDQTNHSTL----VETLRKTKE 428 F A H++ P + +F F + + EL E NH L +ETL++ Sbjct: 44 FYAAFHRTASVPFLNSLRFSGSQSFSSQNQKYPFELFEHRIYNHDPLTQGLLETLKRAAY 103 Query: 429 FTSETEAMDFLDKVEEGVQLDCSLVCSVVWALRNEWELALLGFKWGQKLGCID 587 F E EAM +D GV+ + +LV SV+W LR +W+LA LGFKWG+K GCID Sbjct: 104 FPGEAEAMACIDG--SGVKANINLVYSVIWELRKDWKLAFLGFKWGEKWGCID 154 >ref|XP_002332054.1| predicted protein [Populus trichocarpa] gi|222831940|gb|EEE70417.1| predicted protein [Populus trichocarpa] Length = 444 Score = 61.6 bits (148), Expect = 9e-08 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +3 Query: 435 SETEAMDFLDKVEEGVQLDCSLVCSVVWALRNEWELALLGFKWGQKLGCID 587 SE EAM LD E G++ + +LV SV+W LR EW LA L FKWG K GC+D Sbjct: 7 SEAEAMASLD--ESGIRANQNLVYSVIWELREEWRLAFLAFKWGDKWGCVD 55 >ref|NP_178203.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200729|sp|Q9SAH2.1|PP137_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g80880, mitochondrial; Flags: Precursor gi|6503300|gb|AAF14676.1|AC011713_24 Contains PF|01535 Domain of unknown function [Arabidopsis thaliana] gi|91806121|gb|ABE65789.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332198342|gb|AEE36463.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 540 Score = 58.9 bits (141), Expect = 6e-07 Identities = 33/101 (32%), Positives = 52/101 (51%) Frame = +3 Query: 285 SFIPPSSSRTQFFKHHLFPLKLSTFNLELELDQTNHSTLVETLRKTKEFTSETEAMDFLD 464 S++P +S +F + TF++ L L++ +R+ E SE +AM L+ Sbjct: 60 SYLPHFASSNRFSTKTIS----ETFDINLTALAPLEKGLIDLIRQVSELESEADAMASLE 115 Query: 465 KVEEGVQLDCSLVCSVVWALRNEWELALLGFKWGQKLGCID 587 + L+ S++W LR+EW LA L FKWG+K GC D Sbjct: 116 --DSSFDLNHDSFYSLIWELRDEWRLAFLAFKWGEKRGCDD 154 >ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] gi|449509164|ref|XP_004163514.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] Length = 547 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/66 (39%), Positives = 42/66 (63%) Frame = +3 Query: 390 HSTLVETLRKTKEFTSETEAMDFLDKVEEGVQLDCSLVCSVVWALRNEWELALLGFKWGQ 569 ++ +E ++ SE EA+ LD+ + V+ D LV S +W LR++W+ +LL FKWG+ Sbjct: 83 NARFIELFKRVALLPSEVEAVAALDEFD--VKADLDLVYSAIWVLRDDWKSSLLAFKWGE 140 Query: 570 KLGCID 587 K+G ID Sbjct: 141 KVGAID 146 >ref|XP_002887806.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333647|gb|EFH64065.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 541 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = +3 Query: 399 LVETLRKTKEFTSETEAMDFLDKVEEGVQLDCSLVCSVVWALRNEWELALLGFKWGQKLG 578 L++ +R E SE +AM L+ E L+ S++W LR EW LA L FKWG+K G Sbjct: 88 LIDLIRHVSELESEADAMASLE--ESSFDLNHDSFYSLIWELREEWRLAFLAFKWGEKRG 145 Query: 579 CID 587 C D Sbjct: 146 CDD 148