BLASTX nr result
ID: Coptis25_contig00015078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015078 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX82525.1| S-locus F-box-like protein b [Petunia integrifoli... 59 5e-07 ref|XP_002527480.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >gb|ABX82525.1| S-locus F-box-like protein b [Petunia integrifolia subsp. inflata] Length = 394 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/101 (34%), Positives = 48/101 (47%), Gaps = 2/101 (1%) Frame = -3 Query: 310 PVMSLLRFKFVCKSWRILIESSNFIDQHLNHHSHQYSNYNFVTLSPLRHYGPHPNRRGIN 131 PV +LLRFKF+ K+W LIESS FI+ HLN + + + + S N I Sbjct: 23 PVKALLRFKFISKTWSTLIESSTFINIHLNRATTTNNEFLLFSRSYREETEGFKNALSIL 82 Query: 130 LCLRSGDRFEVTAQVDLPCLHVLYHYRIN--IVACNGIVCL 14 C D + +DLP L Y N + CNG++ L Sbjct: 83 SCGNDDDLIHTISDLDLPYLTFTQRYLFNKLVGPCNGLIVL 123 >ref|XP_002527480.1| conserved hypothetical protein [Ricinus communis] gi|223533120|gb|EEF34878.1| conserved hypothetical protein [Ricinus communis] Length = 379 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/100 (34%), Positives = 51/100 (51%) Frame = -3 Query: 313 LPVMSLLRFKFVCKSWRILIESSNFIDQHLNHHSHQYSNYNFVTLSPLRHYGPHPNRRGI 134 LPV LLR + +CK+W LI + NFI H + ++ +N N++ LRHY + Sbjct: 17 LPVKQLLRCRCICKTWYSLISNHNFISTH-SRYTIDSNNNNYLI---LRHYSRSNKKERF 72 Query: 133 NLCLRSGDRFEVTAQVDLPCLHVLYHYRINIVACNGIVCL 14 L D F ++D P L + Y + +CNGI+CL Sbjct: 73 ALHFDDDDMFSEYQELDFP-LESSWDYFEIVGSCNGIICL 111