BLASTX nr result
ID: Coptis25_contig00015044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015044 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518802.1| PREDICTED: heat shock protein 83-like [Glyci... 80 1e-13 ref|XP_003516650.1| PREDICTED: heat shock cognate 90 kDa protein... 80 1e-13 ref|XP_002514573.1| heat shock protein, putative [Ricinus commun... 80 1e-13 ref|XP_004149483.1| PREDICTED: heat shock protein 83-like [Cucum... 79 4e-13 ref|XP_002444835.1| hypothetical protein SORBIDRAFT_07g028940 [S... 77 1e-12 >ref|XP_003518802.1| PREDICTED: heat shock protein 83-like [Glycine max] Length = 794 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 QITLYLRADDKYEFSEPARLQGLVKNYSQFVSFPIYTWQ 118 QITLYLR DDKYEFSEP+R+QGLVKNYSQFVSFPIYTWQ Sbjct: 257 QITLYLREDDKYEFSEPSRIQGLVKNYSQFVSFPIYTWQ 295 >ref|XP_003516650.1| PREDICTED: heat shock cognate 90 kDa protein-like [Glycine max] Length = 793 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 QITLYLRADDKYEFSEPARLQGLVKNYSQFVSFPIYTWQ 118 QITLYLR DDKYEFSEP+R+QGLVKNYSQFVSFPIYTWQ Sbjct: 256 QITLYLREDDKYEFSEPSRIQGLVKNYSQFVSFPIYTWQ 294 >ref|XP_002514573.1| heat shock protein, putative [Ricinus communis] gi|223546177|gb|EEF47679.1| heat shock protein, putative [Ricinus communis] Length = 634 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 2 QITLYLRADDKYEFSEPARLQGLVKNYSQFVSFPIYTWQ 118 QITLYLR DDKYEFS+PAR+QGLVKNYSQFVSFPIYTWQ Sbjct: 96 QITLYLREDDKYEFSDPARIQGLVKNYSQFVSFPIYTWQ 134 >ref|XP_004149483.1| PREDICTED: heat shock protein 83-like [Cucumis sativus] gi|449518043|ref|XP_004166053.1| PREDICTED: heat shock protein 83-like [Cucumis sativus] Length = 781 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 QITLYLRADDKYEFSEPARLQGLVKNYSQFVSFPIYTWQ 118 QITLYLR DDKYEFS+P R+QGLVKNYSQFVSFPIYTWQ Sbjct: 252 QITLYLREDDKYEFSDPTRIQGLVKNYSQFVSFPIYTWQ 290 >ref|XP_002444835.1| hypothetical protein SORBIDRAFT_07g028940 [Sorghum bicolor] gi|241941185|gb|EES14330.1| hypothetical protein SORBIDRAFT_07g028940 [Sorghum bicolor] Length = 788 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/39 (84%), Positives = 39/39 (100%) Frame = +2 Query: 2 QITLYLRADDKYEFSEPARLQGLVKNYSQFVSFPIYTWQ 118 QITL+LR+DDKYEF++P+R+QGLVKNYSQFVSFPIYTWQ Sbjct: 253 QITLFLRSDDKYEFADPSRIQGLVKNYSQFVSFPIYTWQ 291