BLASTX nr result
ID: Coptis25_contig00015007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00015007 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276795.1| PREDICTED: protein TIC 20-II, chloroplastic ... 61 1e-07 >ref|XP_002276795.1| PREDICTED: protein TIC 20-II, chloroplastic [Vitis vinifera] gi|147792791|emb|CAN71033.1| hypothetical protein VITISV_000355 [Vitis vinifera] Length = 218 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/57 (47%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -2 Query: 438 LMIVPSLLHVVFPYGE-GFGFKIIQVVHSAFFVVVLCCFVYALGFCIFGKKPYFPKV 271 L++VP L++ +F G G GF+++ + H+A FV V+ CF+Y+LGFCI G+ PY P V Sbjct: 154 LLVVPLLVNRIFNPGRAGVGFRLMVMGHNAIFVFVVACFLYSLGFCILGRTPYLPFV 210