BLASTX nr result
ID: Coptis25_contig00014806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014806 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552953.1| PREDICTED: protease Do-like 7-like [Glycine ... 102 3e-20 ref|NP_566204.2| protease Do-like 7 [Arabidopsis thaliana] gi|75... 100 9e-20 ref|XP_003538402.1| PREDICTED: protease Do-like 7-like [Glycine ... 100 9e-20 dbj|BAE99146.1| hypothetical protein [Arabidopsis thaliana] 100 9e-20 gb|AAF01593.1|AC009895_14 unknown protein [Arabidopsis thaliana] 100 9e-20 >ref|XP_003552953.1| PREDICTED: protease Do-like 7-like [Glycine max] Length = 1113 Score = 102 bits (254), Expect = 3e-20 Identities = 51/64 (79%), Positives = 58/64 (90%) Frame = -1 Query: 431 FVRGLPVYAISKVLNKIISCRKGTGLLINGIKMPMPLVRILEVELYPTLLSKARSFGLSD 252 FVRG+P+YAIS+VL+KIIS G+ LLING+K PMPLVRILEVELYPTLLSKARSFGLSD Sbjct: 830 FVRGIPIYAISQVLDKIISGANGSPLLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD 889 Query: 251 D*VQ 240 D +Q Sbjct: 890 DWIQ 893 >ref|NP_566204.2| protease Do-like 7 [Arabidopsis thaliana] gi|75330785|sp|Q8RY22.1|DEGP7_ARATH RecName: Full=Protease Do-like 7 gi|19310429|gb|AAL84951.1| AT3g03380/T21P5_20 [Arabidopsis thaliana] gi|27363448|gb|AAO11643.1| At3g03380/T21P5_20 [Arabidopsis thaliana] gi|332640417|gb|AEE73938.1| protease Do-like 7 [Arabidopsis thaliana] Length = 1097 Score = 100 bits (250), Expect = 9e-20 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -1 Query: 431 FVRGLPVYAISKVLNKIISCRKGTGLLINGIKMPMPLVRILEVELYPTLLSKARSFGLSD 252 FVRG+PVYAIS+VL KII+ G LLING+K PMPLVRILEVELYPTLLSKARSFGLSD Sbjct: 818 FVRGIPVYAISQVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD 877 Query: 251 D*VQV 237 + +QV Sbjct: 878 EWIQV 882 >ref|XP_003538402.1| PREDICTED: protease Do-like 7-like [Glycine max] Length = 1113 Score = 100 bits (250), Expect = 9e-20 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -1 Query: 431 FVRGLPVYAISKVLNKIISCRKGTGLLINGIKMPMPLVRILEVELYPTLLSKARSFGLSD 252 FVRG+P+YAIS+VL+KIIS G+ LLING++ PMPLVRILEVELYPTLLSKARSFGLSD Sbjct: 830 FVRGIPIYAISQVLDKIISGANGSPLLINGVERPMPLVRILEVELYPTLLSKARSFGLSD 889 Query: 251 D*VQ 240 D +Q Sbjct: 890 DWIQ 893 >dbj|BAE99146.1| hypothetical protein [Arabidopsis thaliana] Length = 527 Score = 100 bits (250), Expect = 9e-20 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -1 Query: 431 FVRGLPVYAISKVLNKIISCRKGTGLLINGIKMPMPLVRILEVELYPTLLSKARSFGLSD 252 FVRG+PVYAIS+VL KII+ G LLING+K PMPLVRILEVELYPTLLSKARSFGLSD Sbjct: 248 FVRGIPVYAISQVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD 307 Query: 251 D*VQV 237 + +QV Sbjct: 308 EWIQV 312 >gb|AAF01593.1|AC009895_14 unknown protein [Arabidopsis thaliana] Length = 443 Score = 100 bits (250), Expect = 9e-20 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -1 Query: 431 FVRGLPVYAISKVLNKIISCRKGTGLLINGIKMPMPLVRILEVELYPTLLSKARSFGLSD 252 FVRG+PVYAIS+VL KII+ G LLING+K PMPLVRILEVELYPTLLSKARSFGLSD Sbjct: 164 FVRGIPVYAISQVLEKIITGGNGPALLINGVKRPMPLVRILEVELYPTLLSKARSFGLSD 223 Query: 251 D*VQV 237 + +QV Sbjct: 224 EWIQV 228