BLASTX nr result
ID: Coptis25_contig00014687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014687 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 102 4e-20 ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-17 ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus c... 93 3e-17 ref|XP_002993709.1| hypothetical protein SELMODRAFT_137449 [Sela... 58 7e-07 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 102 bits (253), Expect = 4e-20 Identities = 44/67 (65%), Positives = 56/67 (83%) Frame = +2 Query: 8 KPFQGILYYVVKSNLVLAEFGDDFHRQHSSTRRYDVSFSFNRVCLKRCHQAVASVTDPLF 187 +P+QG++Y VV+S +VL EFG+DF QH STR YDVSFSFNRVCLKR HQA+ + +DP F Sbjct: 441 EPYQGVIYRVVRSTIVLVEFGEDFLLQHHSTREYDVSFSFNRVCLKRAHQAIEAASDPSF 500 Query: 188 RNFLFPS 208 +NFLFP+ Sbjct: 501 KNFLFPN 507 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 99.8 bits (247), Expect = 2e-19 Identities = 43/67 (64%), Positives = 54/67 (80%) Frame = +2 Query: 8 KPFQGILYYVVKSNLVLAEFGDDFHRQHSSTRRYDVSFSFNRVCLKRCHQAVASVTDPLF 187 +PFQGI+Y V +S VL EFG+DFH QH S ++YDVSFSFNRVCL+R HQA+ + +DP F Sbjct: 386 EPFQGIIYRVQRSTTVLVEFGEDFHAQHCSFQKYDVSFSFNRVCLRRAHQAIEAASDPSF 445 Query: 188 RNFLFPS 208 NF+FPS Sbjct: 446 ENFIFPS 452 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/71 (60%), Positives = 54/71 (76%) Frame = +2 Query: 8 KPFQGILYYVVKSNLVLAEFGDDFHRQHSSTRRYDVSFSFNRVCLKRCHQAVASVTDPLF 187 +P QGI+Y V +S V+ EFG DF QH STR+YDVSFSFNRVCLKR H A+ + +DPLF Sbjct: 359 EPCQGIIYRVERSTRVVVEFGKDFLLQHHSTRKYDVSFSFNRVCLKRAHHAIEAASDPLF 418 Query: 188 RNFLFPSQKSR 220 ++FLFP S+ Sbjct: 419 KSFLFPDGVSK 429 >ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus communis] gi|223524877|gb|EEF27754.1| hypothetical protein RCOM_0173910 [Ricinus communis] Length = 171 Score = 92.8 bits (229), Expect = 3e-17 Identities = 41/69 (59%), Positives = 52/69 (75%) Frame = +2 Query: 14 FQGILYYVVKSNLVLAEFGDDFHRQHSSTRRYDVSFSFNRVCLKRCHQAVASVTDPLFRN 193 FQGI+Y V +S +L EFG+DFH QH + +YDVSFSFNRVCLKR HQAV + +DP F + Sbjct: 76 FQGIIYRVERSTTILVEFGEDFHAQHYPSMKYDVSFSFNRVCLKRAHQAVEAASDPSFES 135 Query: 194 FLFPSQKSR 220 ++FP SR Sbjct: 136 YIFPCWGSR 144 >ref|XP_002993709.1| hypothetical protein SELMODRAFT_137449 [Selaginella moellendorffii] gi|300138433|gb|EFJ05201.1| hypothetical protein SELMODRAFT_137449 [Selaginella moellendorffii] Length = 823 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +2 Query: 8 KPFQGILYYVVKSNLVLAEFGDDFHRQHSSTRRYDVSFSFNRVCLKRCHQAVASVTDPLF 187 K ++G ++ V + V +F +DFHR R+DV FSF+R LKRCH AVAS++ L Sbjct: 280 KEYEGYVHRV-NAEEVFLKFANDFHRVFIQGTRFDVRFSFSRTNLKRCHHAVASISPQLC 338 Query: 188 RNFLFPS 208 F+FP+ Sbjct: 339 NMFVFPN 345