BLASTX nr result
ID: Coptis25_contig00014657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014657 (760 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 76 9e-12 ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|2... 76 9e-12 ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|2... 76 9e-12 ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 74 3e-11 gb|AFK46198.1| unknown [Lotus japonicus] 74 3e-11 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 75.9 bits (185), Expect = 9e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 616 RCWRSGTFPLCDGSHAKHNKETGDNVGPLLLKKQ 717 RCWRSGTFPLCDGSH KHNK TGDNVGPLLLKKQ Sbjct: 76 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 109 >ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|222868850|gb|EEF05981.1| predicted protein [Populus trichocarpa] Length = 168 Score = 75.9 bits (185), Expect = 9e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 616 RCWRSGTFPLCDGSHAKHNKETGDNVGPLLLKKQ 717 RCWRSGTFPLCDGSH KHNK TGDNVGPLLLKKQ Sbjct: 133 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 166 >ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|222859540|gb|EEE97087.1| predicted protein [Populus trichocarpa] Length = 107 Score = 75.9 bits (185), Expect = 9e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +1 Query: 616 RCWRSGTFPLCDGSHAKHNKETGDNVGPLLLKKQ 717 RCWRSGTFPLCDGSH KHNK TGDNVGPLLLKKQ Sbjct: 72 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 105 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 73.9 bits (180), Expect = 3e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 616 RCWRSGTFPLCDGSHAKHNKETGDNVGPLLLKK 714 RCWRSGTFPLCDGSH KHNK TGDNVGPLLLKK Sbjct: 76 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 108 >gb|AFK46198.1| unknown [Lotus japonicus] Length = 118 Score = 73.9 bits (180), Expect = 3e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +1 Query: 616 RCWRSGTFPLCDGSHAKHNKETGDNVGPLLLKK 714 RCWRSGTFPLCDGSH KHNK TGDNVGPLLLKK Sbjct: 86 RCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK 118