BLASTX nr result
ID: Coptis25_contig00014256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014256 (1971 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 49 8e-07 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 48.5 bits (114), Expect(2) = 8e-07 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 8/71 (11%) Frame = +3 Query: 774 LNYETILYVLKQLEKYPHRALDFLN--------KPSLTVYNLVLRILGCKKP*MSFGMLS 929 L +ET++YVLK+L+K PH+A DF N KPS +Y+L+LRIL K +F + Sbjct: 90 LTHETVIYVLKKLDKDPHKAWDFFNWVCDRNGFKPSSPLYSLMLRILVKKDSMKNFWIT- 148 Query: 930 FVNKISSKGRY 962 + K+ +G Y Sbjct: 149 -LRKMKEQGFY 158 Score = 32.7 bits (73), Expect(2) = 8e-07 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 5/84 (5%) Frame = +2 Query: 509 SVLVFLLIESFH-PTRTSASRFLHFQMTQAFAIVSLYAAR*IEGREY----DLLITHQKL 673 ++LV L + +F TR S +R Q+T F RE+ D + H+KL Sbjct: 6 TILVSLRLSNFLLSTRISTTRPFLTQVTHFFPCFL--------SREHSYTSDYVNIHKKL 57 Query: 674 YFSCTPSSIVELLMMNEMVRRVRT 745 Y S PSS+VELL +N+ + T Sbjct: 58 YSSSKPSSLVELLSVNDWSPELET 81