BLASTX nr result
ID: Coptis25_contig00014096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014096 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526685.1| light-inducible protein atls1, putative [Ric... 84 9e-15 gb|AFK45267.1| unknown [Lotus japonicus] 83 3e-14 gb|AFK37368.1| unknown [Lotus japonicus] 83 3e-14 gb|ACF06473.1| light-inducible protein ATLS1 [Elaeis guineensis] 83 3e-14 gb|AFK44196.1| unknown [Medicago truncatula] 81 1e-13 >ref|XP_002526685.1| light-inducible protein atls1, putative [Ricinus communis] gi|223533985|gb|EEF35707.1| light-inducible protein atls1, putative [Ricinus communis] Length = 115 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +2 Query: 2 DTNKKLSAAIATILETKLSVPKNRFFLKFYDSKGSNFGYNGSTF 133 DTNKKLSAAIA ILETKLSVPK+RFFLKFYD+KGSNFG+NGSTF Sbjct: 72 DTNKKLSAAIAAILETKLSVPKSRFFLKFYDTKGSNFGWNGSTF 115 >gb|AFK45267.1| unknown [Lotus japonicus] Length = 76 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 DTNKKLSAAIATILETKLSVPKNRFFLKFYDSKGSNFGYNGSTF 133 D NKKLSAAIA+ILETKLSVPK+RFFLKFYD+KGSNFG+NGSTF Sbjct: 33 DVNKKLSAAIASILETKLSVPKSRFFLKFYDTKGSNFGWNGSTF 76 >gb|AFK37368.1| unknown [Lotus japonicus] Length = 115 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 DTNKKLSAAIATILETKLSVPKNRFFLKFYDSKGSNFGYNGSTF 133 D NKKLSAAIA+ILETKLSVPK+RFFLKFYD+KGSNFG+NGSTF Sbjct: 72 DVNKKLSAAIASILETKLSVPKSRFFLKFYDTKGSNFGWNGSTF 115 >gb|ACF06473.1| light-inducible protein ATLS1 [Elaeis guineensis] Length = 115 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +2 Query: 2 DTNKKLSAAIATILETKLSVPKNRFFLKFYDSKGSNFGYNGSTF 133 D NKKLSAAIA+ILETKLSVPK+RFFLKFYD+KGSNFG+NGSTF Sbjct: 72 DVNKKLSAAIASILETKLSVPKSRFFLKFYDTKGSNFGWNGSTF 115 >gb|AFK44196.1| unknown [Medicago truncatula] Length = 115 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 2 DTNKKLSAAIATILETKLSVPKNRFFLKFYDSKGSNFGYNGSTF 133 D NKKLSAAIA ILETKLSVPK RFFLKFYD+KGSNFG+NG+TF Sbjct: 72 DVNKKLSAAIAAILETKLSVPKTRFFLKFYDTKGSNFGWNGTTF 115